KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0669Help
Entry
M28_Spy0669       CDS       T00263                                 

Gene name
dyr
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00670  One carbon pool by folate
spb00790  Folate biosynthesis
spb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M28_Spy0669 (dyr)
   00670 One carbon pool by folate
    M28_Spy0669 (dyr)
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     M28_Spy0669 (dyr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AAX71782
UniProt: Q48U24
Position
690415..690912
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAVLMGRVTFEGMNCKRLPQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcagtcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagacttcctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttatttcgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgaccaaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system