KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0781
Entry
M28_Spy0781       CDS       T00263                                 

Gene name
srtA
Definition
(GenBank) lantibiotic
  KO
K20482  lantibiotic bacteriocin
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb02020  Two-component system
spb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M28_Spy0781 (srtA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M28_Spy0781 (srtA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spb02000]
    M28_Spy0781 (srtA)
Transporters [BR:spb02000]
 Other transporters
  Pores ion channels [TC:1]
   M28_Spy0781 (srtA)
SSDB
Motif
Pfam: Gallidermin
Other DBs
NCBI-ProteinID: AAX71894
UniProt: Q48TR2
Position
804262..804402
AA seq 46 aa
MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
NT seq 141 nt   +upstreamnt  +downstreamnt
atgaataacacaattaaagactttgatctcgatttgaaaacaaataaaaaagacactgct
acaccttatgttggtagccgttacctatgtacccctggttcttgttggaaattagtttgc
tttacaacaactgttaaataa

DBGET integrated database retrieval system