KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1104Help
Entry
M28_Spy1104       CDS       T00263                                 

Definition
(GenBank) transposase
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_Tnp_1_assoc
Motif
Other DBs
NCBI-ProteinID: AAX72217
UniProt: Q48S98
Position
complement(1109097..1110239)
Genome map
AA seq 380 aa AA seqDB search
MTTMIDFIISIDDCAVELDSRQSWKIRYPLSTILFLVFVCQLAGIETWKEMEDFIEMNEP
LFATYVDLSEGCPSHDTLERVISLVNTDRLKELKVQFEQSLTSLDAVHQLISVDGKTIRG
NRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLRTIDIRKSIVTIDAMGTQ
TAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQENAQYYQTVEKSRGQIE
VREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENRYFIFSFKPAVLTFANC
VRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNFIRKMCLYFLKVMVFPKKDLSYRRK
QRYISVHLEDYLVQLFGERG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgactacgatgattgattttattatttctattgatgattgcgcagttgaattggatagt
cgtcaatcttggaaaattcgctaccccttatcaaccattctatttcttgtcttcgtttgt
cagttagctggcattgaaacctggaaggagatggaagattttattgaaatgaatgaacca
ttgtttgcgacctacgttgatttgagtgaaggttgtccgtctcatgataccttagagcgt
gtgattagtcttgttaatacagaccgtttaaaagagcttaaagttcaatttgagcaatca
ttgacaagcttagatgccgttcatcaactgatttcagtggacggtaaaacgattcgaggc
aatcgaggtaaaaatcagaagcctgttcatattgtaacggcttatgatgggggtcatcat
cttagtttgggacaggtagcggttgaggagaaaagtaatgaaattgttgccattcctcag
ttattgcggacaattgatatccgtaaaagcattgtaacgatagacgcaatgggcacgcag
acggctatcgttgatacgattataaaaggtaaagcagactattgcttagccgtcaaagga
aatcaagaaacactttatgatgatattgctctttattttagtgatgtcaacttattggaa
gaactccaagaaaatgcacagtattatcagactgttgaaaaatctaggggacagattgaa
gttagagaatactgggtgtcttccgatatcaaatggttgtgtcaaaaccatcccaaatgg
cataagttacgtggtattgggatgactcgtaatacgattgataaggatggtcagctgagt
caagagaatcgttattttatctttagctttaagccggctgtcctcacatttgccaattgt
gtacgaggtcattggcagatagagagtatgcactggttattggacgttgtttatcatgaa
gatcatcatcagacattggataaaagagccgcatttaacctaaattttatccgaaaaatg
tgcttatattttctcaaagtgatggtatttcctaaaaaagacctcagttatcgtcgcaaa
caacggtatatttctgtccatttggaagattatttagtccaattatttggagagagaggc
taa

DBGET integrated database retrieval system