KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1303Help
Entry
M28_Spy1303       CDS       T00263                                 

Definition
(GenBank) DNA integration/recombination/invertion protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase AbiGii_2 Arm-DNA-bind_4 ART
Motif
Other DBs
NCBI-ProteinID: AAX72413
UniProt: Q48S97
Position
complement(1286437..1287573)
Genome map
AA seq 378 aa AA seqDB search
MATYRQRGKKKLWDYRVYGKDGKLIASGSGFRTKKEASYEALKIEQKKYYSDVINSNATL
FEMWQIWYDLVVEPSELDILTKQKYQARGKIIEKYLSDIPANRIKHSKYQEFIKFYGKNV
TLNLMTCLNSDIRKVIIFFKRDGVLIEDFTEGVKIFGKPYRKSPEDKYLKSIEDYQKLLA
YLKRIANYSDSIIPFFLFTMLQTGFRFGEAMAITWDDIDFERNSIYTYRRYSSIKKDFTK
PKTRTSIRRVPVSHDLKELLLELKFQQERMLRGLHIKNTDQLIFYDYRFGMISNNAVNKF
LASSLEKLEIESKMSSTGARHTYGSYLLANGVDIWAVAKLMGHKDIKQLIETYGHLLLEV
EEKENDQLLKILNNKGSF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatatagacaaagaggtaaaaagaaattatgggattatcgtgtttatggtaaa
gatggaaaattaatagcatctggttcaggctttagaacaaaaaaagaagcatcatatgaa
gctttaaaaattgagcaaaaaaaatattattcagatgttataaattccaatgctacatta
tttgagatgtggcaaatatggtatgatcttgttgttgagccaagtgaattagatattctt
actaagcaaaaatatcaagcccgaggaaagataattgaaaaatatttatctgatatccct
gctaatagaattaaacatagtaagtatcaagaatttattaagttttatggtaaaaatgta
actttgaatttaatgacttgtttgaattcagatattagaaaggttataattttttttaaa
agggacggagttttaattgaagattttacagaaggagttaaaatttttggaaaaccatat
aggaagtcgccagaggataagtatttaaaaagtattgaagattatcaaaaattattagca
tatttaaaaagaatagctaattattcagactcaataatccctttttttcttttcacaatg
ttacaaactggttttaggtttggtgaagcaatggcaataacttgggatgatattgatttt
gaaagaaatagtatttatacatatcgaagatattcttcaataaaaaaggactttacaaag
cctaaaacaaggacttcaataaggagagttccagtaagtcatgatttaaaagagttattg
cttgaactaaaatttcaacaagaaagaatgctgagaggtttgcatataaaaaatacagat
caattgattttttatgactataggtttggtatgatatcaaataatgctgttaacaaattc
ttggcaagctcattggaaaaattagaaatagaatctaagatgtcatcaacaggtgctaga
catacttatggaagttatttgttggctaacggagtagatatttgggcggttgcaaaatta
atggggcataaagatatcaaacaattaatagaaacatatggtcatttgcttctggaggtg
gaagaaaaggaaaatgatcagcttttaaaaattcttaataataaaggtagtttttaa

DBGET integrated database retrieval system