KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1305Help
Entry
M28_Spy1305       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S3Ae
Motif
Other DBs
NCBI-ProteinID: AAX72415
UniProt: Q48S95
Position
complement(1288122..1288664)
Genome map
AA seq 180 aa AA seqDB search
MLNYKYITLNDSYELNVWLDFVLRDLKKEEKYSKFRFIIKKLSIKNSRTTFQEIESVRKE
LMGLSELDLKHLRMIIENRETTGIGLEFKAFLQKIFNYFGVIVVGLIPVILGYNSIERVV
TSWLNAKTFKSSILLIVWIFVLYIYYVVFKEFFLHDSKKREVRKYLLFLINDILLDMEKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaactataagtatattactctaaatgatagttatgagttaaatgtttggttagat
tttgtattacgtgatttaaaaaaggaagaaaagtattctaaatttagatttataataaaa
aaattgtctattaaaaattcaagaactacatttcaagaaatcgaaagtgttcgtaaagaa
ttaatgggactatcagaacttgatttgaagcatttaagaatgataattgaaaatagagag
acaacagggattggtttagaattcaaagcatttttacaaaagatatttaattattttggt
gtgattgtagtaggtttaattccagtaatattaggttataattcaatagagagagttgta
acttcttggttaaatgccaaaacttttaaatctagtattttattaattgtatggatattt
gttttatatatttattatgtagtttttaaagaattctttttgcatgattctaaaaaaaga
gaagttagaaagtatttgttatttttgataaatgatattttattagatatggagaaacgt
tga

DBGET integrated database retrieval system