KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1306Help
Entry
M28_Spy1306       CDS       T00263                                 

Definition
(GenBank) putative cell surface protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gram_pos_anchor MarB
Motif
Other DBs
NCBI-ProteinID: AAX72416
UniProt: Q48S94
Position
complement(1288887..1289648)
Genome map
AA seq 253 aa AA seqDB search
MTKEKMMSFMTIASIALLGSGVVCANDVADPVAGTTDAVVVPVSPQPTTPIEHTGTDTTN
KIVDSTKPSEDKVADSTDQLIPPVKSDLETSEDKVTDPTETKPSKEKTEEPVKSNDSEVI
PEQPKSEEVKKAEENTGASTTETPKPVTKPVIETPIVTNTGYTVLGTQDGNVWVQTETGN
VLKPAIAIGAVKQKDGTVALKTRDGKLEVLPSTGETKTILAILGGLAILGAIWVGWKENI
KKYLTFLKKKSKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaaaatgatgagttttatgacgattgcaagtattgctttgcttggaagt
ggggtggtttgtgctaatgatgtagcagatccagtagcaggaacaacggatgcagtggtg
gtaccagtctcacctcaaccaacgacaccgattgagcatacaggaacagatactaccaat
aaaattgttgactcgactaagccaagcgaggacaaggtggcagatagtactgatcagcta
atccctccagttaaatcagatttagaaacaagcgaggataaagtaacagatccaacggag
actaagccaagcaaagagaagacggaagagcctgttaagtccaatgattcagaagtgatt
ccagaacaacctaagtcagaagaggtgaaaaaagctgaagaaaatacaggtgctagtaca
actgaaactcctaaacctgtgacgaaacctgttattgagacaccaattgttacgaataca
ggctacacggttttgggaacgcaagatggcaatgtttgggttcaaacagaaactggtaat
gtactgaaacctgcgatagcaattggtgctgtaaagcaaaaagatggtacagttgcctta
aaaacaagagatgggaagttagaagtcttaccatcaactggagagactaaaacaatctta
gccattttgggaggtttagctattttaggagctatctgggtaggttggaaagaaaatatc
aaaaagtatttaacgtttttgaaaaagaaaagtaaaaaataa

DBGET integrated database retrieval system