KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1308Help
Entry
M28_Spy1308       CDS       T00263                                 

Definition
(GenBank) hypothetical exported protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme2 CHAP DUF2202
Motif
Other DBs
NCBI-ProteinID: AAX72418
UniProt: Q48S92
Position
complement(1290230..1291588)
Genome map
AA seq 452 aa AA seqDB search
MLMSIPFFIVVIVTIIFSSSQGDCQVTPDLSTQFVTSSDSASQTDWTKKGSIANVTAGKV
FHAWVSKGLSGASAAGIVGWVNSEGGFAMIGRAEGHYGNDLRTNSIAFGVKPIGLSYYTT
EAGGGIYQFTPYTKYAPLGDPKWENADAMNEFVAKAILAGDWNASMDLTGGNHTFKQMAQ
MTDPKQATLVWQAYERGSTAHINPFQKQADAQKAYELFGGVKYSYNEIVFHKSFDIFGPL
KPGEGESKEVVLSLCESGSYSKGAFGKDRTGKVNYTSYNAWRPEQLPADLKPYALDPRSV
GLNYRQAVGWYAIASTGGQCTDLSASLMYALWSKNGSHPTQKAGNGNMVVANWVRTFGGS
SDKSPTSGAVFSSAGTSSAGHTGVVSHVFENGDILIVEQNYASYSGDDGGFGKYSWNYRY
VTTAELKNEGYTFYNPAKLGYQIMKSVGTVGK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgcttatgagcattcctttttttattgtagttatcgttacgatcatatttagcagcagt
caaggtgattgtcaagtaactcctgatttatcaacacaatttgttacctcaagtgattct
gcttcacaaaccgattggacaaagaaaggctcaattgcgaatgtcacagcaggtaaagtc
tttcacgcttgggtatcgaaaggcttgtcaggcgcttctgccgcaggaattgtaggttgg
gttaattccgaaggtggttttgccatgataggtcgagcagaaggacattatggtaatgat
ttacgaactaattctatagcttttggagtgaaaccaattggtttgagttactatacgaca
gaagcaggtggaggtatttatcaatttaccccttataccaaatatgcccctttaggtgat
cctaagtgggagaatgcggatgccatgaacgaatttgttgcaaaagccattctagctggt
gattggaatgcttcaatggatttgacaggaggaaatcatacctttaagcaaatggcccag
atgaccgatccgaaacaggctacgctagtttggcaagcttatgaacgtggtagtactgcc
catattaatccatttcaaaagcaagcagatgctcaaaaagcgtatgagttattcggtgga
gttaaatatagttataatgaaatagtatttcataaatcttttgacatttttggtccacta
aagccgggggaaggggaatcaaaagaagtcgttttatcattatgcgaatcaggttcttac
tctaagggggcttttgggaaagatcgtacaggcaaagtcaactatacttcctacaatgct
tggcgaccagaacaattgcctgcagatttaaaaccttatgcgctcgatcccagatcagtt
ggcttgaattatcgacaagcggttggctggtatgcgattgcttcgacagggggtcaatgt
accgatctttctgcgagtttgatgtatgctttgtggtcaaaaaatggtagccatccaaca
caaaaggcaggtaatggtaatatggttgttgctaattgggttaggacttttggcggttca
tctgataaatcaccaacttcaggagctgtattttcctctgcagggactagttctgctggc
catacaggtgttgtcagccatgtttttgaaaatggggatattttaattgtggaacaaaat
tatgcatcttattcgggtgatgatggtggctttgggaaatactcttggaactatcgctat
gtcactactgcagaattaaaaaatgaaggatatactttttacaatcctgcgaaactcggt
tatcagattatgaaatcagtaggaacggtaggtaaataa

DBGET integrated database retrieval system