KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1311Help
Entry
M28_Spy1311       CDS       T00263                                 

Definition
(GenBank) DNA segregation ATPase related protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF87 AAA_14 IstB_IS21 FtsK_SpoIIIE Methyltransf_32 T2SSE AAA_22 DEAD Sigma54_activat ResIII DUF2075 TrwB_AAD_bind ABC_tran AAA_16 Zeta_toxin NACHT ATPase_2 DUF815 DUF853 CbiA
Motif
Other DBs
NCBI-ProteinID: AAX72421
UniProt: Q48S89
Position
complement(1294364..1296865)
Genome map
AA seq 833 aa AA seqDB search
MVKKLEYPINSIHSNLALRKDKVVIAYYRIPNTPITITDSDKKDSHKDKVAQVIKKLAKY
KHFDISLVPKDYLLEEKMSDFIGDLADDVKDLGIDTLSYTVDTLTAEIEIPYQFDWVIGV
NLGRDTMSATLKELAVKQLDLIADNVASLLGYTVELDKEWYKEYQDEELLLYGLLSSLKA
KRLSEEDLFYYQRMQYLRYIPHAKNEVIANRTLLNVTDTLVKPLSGGFLKLESPYGSSFI
TILPVGKFNTIFNGFHLGELVQRMSFPVELRFKAEFINKTKLSGTMGRSNTRYDQIMKEA
YSTNTVQQDDILMGSYSLKDLMKKVGNKEEIIEYGCFLVVSGSSIKQLRQRRHAVLSYFA
DMQVNVHEASHDTPYLFQTLLYGQNLQKTTRKWNHLVTSRGFSEMMLFTNTQSGNRIGWY
IGRVDNRLSAWDNIGEAIMGSKNLVLFNATVANKEDVAGKVTKNPHIIITGATGQGKSYL
AQMIFLHTAQQNVRVLYIDPKRELRKHYLQVVSDPEYAKQFPLRKHQIEQINFVTLDSAM
KENHGVLDPIVILDKEDASSTAKNILLYLLRNATEVKIVQTTALTEAISEVISRRENGEV
VGFNQVIETLCQSDNQDIVDVGHYFKAIIKNSILELAFSDGNVKGLSYEERVTVLEVADL
SLPKDGSDHISDHESNSIALMFALGAFCKHFGERTNEETVEIFDEAWILMQSSEGKAVIK
SMRRVGRSKYNVLMLVSQSVHDAENDDDTTGFGTIFAFYEKSEREAILTHVGLEVNEKNL
EWIDNMISGQCLYYDVYGNLNMMSVHNIHPDIDPLLKPMKQSVSSHLENKYAS
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagttggaatatccaattaatagcattcacagtaatttagctttgcgaaaa
gataaagtggttattgcctactatcggattccaaatacgccaatcactattactgatagt
gataaaaaagatagtcataaagacaaggtagcacaggttatcaaaaaattagctaaatac
aagcattttgatatttcactggtaccaaaagattaccttttagaggaaaaaatgtctgat
tttattggtgacttggcagatgatgttaaggatttaggtatagatacattgagttacact
gttgacacgttgacagctgagattgaaataccttatcaatttgattgggttattggtgtt
aatttaggtagggatacaatgagtgctacactaaaagaacttgcggtaaagcaattggat
ttaattgcagataatgtcgcctctttgttgggatacactgtggaacttgataaggagtgg
tataaagagtaccaagatgaagaattattgctgtatggtttgttatcatcactgaaagct
aagagattatctgaagaagatttattttattatcaacgcatgcaatacttacgctatatc
ccacatgctaaaaatgaagttattgccaatagaacattgttgaacgtaacagatacttta
gttaagcccctgtcgggaggttttttaaagttagaaagtccgtatggtagttcatttata
acgattctaccagttgggaagtttaatactatcttcaatgggttccacttaggtgaactc
gtacagcggatgagttttcctgttgagttacgatttaaagcagaatttattaataaaact
aagttaagtggaacaatgggacgctcgaatacacgttatgatcaaattatgaaagaagcc
tactccacgaatacagtgcaacaagatgatattctaatgggctcatattcattaaaagac
ttgatgaagaaagttggaaataaagaagaaatcattgaatacggttgttttttggtggtt
tctgggtctagtatcaaacaattaaggcaacgtaggcatgctgttttaagttactttgcg
gatatgcaagtcaatgtacatgaagctagtcatgatacaccttatttattccaaacgtta
ctttatggtcaaaatttacagaagacaacacgtaaatggaatcacttagtgaccagtcgt
gggtttagtgaaatgatgttatttacaaatacccagtcaggtaacaggattggctggtat
attggtcgagtcgataatcgtttatctgcttgggataatattggtgaagcgattatgggc
tcgaagaacttagttttgtttaatgcaacggttgcgaataaggaggatgttgctggtaaa
gtaactaaaaatcctcatattatcattacaggtgcgacaggtcaggggaagtcctacctt
gcacagatgatttttttacatactgcgcaacaaaatgttagagtgctttatattgatcct
aagagagagttaaggaaacactatttacaagtggtgtctgatcccgagtatgcgaaacaa
tttccactgagaaaacatcagattgagcaaattaattttgtgacattggatagtgcgatg
aaggaaaaccatggggttttagatcctatcgttatcttggataaagaagatgcctcgtct
actgctaaaaatatattgctttatctgttaagaaatgcgacagaagttaagattgtacaa
actactgctttgacagaggccattagtgaagtaatctcaagacgtgaaaatggggaagtc
gttggctttaatcaagtcattgagacattatgtcaatcagataatcaggatattgtagat
gtaggacattattttaaagctattattaagaattctattttggaattggctttttcggat
ggtaatgttaaaggattatcatatgaagagcgtgtgacagttttagaagttgcggactta
tcgttacctaaagatggttcagatcatatatctgatcatgaaagtaattcaatcgcttta
atgtttgctttaggtgctttttgtaagcactttggggaacgaaccaatgaggaaactgtt
gaaatttttgatgaggcttggattctgatgcagtcatcagaaggtaaggccgttatcaag
tctatgcgccgcgttggtcgttctaagtacaatgttttaatgttagtgtctcaatcagta
catgatgccgaaaatgatgacgatacgactggttttggtactattttcgctttttacgaa
aaatcagaacgggaagctattttaactcatgttggtttggaagtgaacgaaaagaacctg
gagtggattgataacatgatttcaggacaatgcctttattatgatgtttatggcaacctc
aatatgatgtctgtccataacattcatccagatattgatcccttattaaaaccaatgaaa
cagtctgtttcaagccacttagaaaataaatacgcttcgtag

DBGET integrated database retrieval system