KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1314Help
Entry
M28_Spy1314       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TpcC
Motif
Other DBs
NCBI-ProteinID: AAX72424
UniProt: Q48S86
Position
complement(1297587..1298537)
Genome map
AA seq 316 aa AA seqDB search
MDYLVKIKKFLLRYTKKEKGGKQPKPKEVKQKTANIIVYGILGLLFIVGFFGSLRAIGLS
NQVNSLKATVLSSKQQNGKDTKEILDIPRVQYYMNNFVYTYINYSDDTATKRKEELDNYY
SFSTANLVDDVKKERKLQTQRLVSVEQEEDYHIALMRIGYEVDSKSYQMTLAIPFRMANG
LLAIVSPPYTLAEDLFQGKSKSFERKTVDQVKSLPKQEMLSIQKFLPVFFDKYALSNEID
LKLLMKHPELMGGNYRVKSLDANNARYYQDKSNQVVQLMVTFEDMVTGGTRSENFTLYLI
KSDNGWYVDKLYHYFK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtgaaaataaaaaagtttctattgagatatacaaagaaagaaaaagga
ggaaagcagcctaaaccaaaggaagtaaaacaaaagacagccaatattattgtctatgga
attttaggattattatttattgtaggattttttggctcattaagggcaattggtttgtca
aatcaagtaaatagtttaaaagctacggttttatcaagcaagcaacaaaacggaaaagat
acaaaggaaatcttagacattcctagagtgcagtattacatgaacaattttgtgtatact
tacatcaactattctgatgatacggctacaaaacgtaaagaagaattagataattattat
tctttttcaacagctaatcttgttgatgatgttaaaaaggagcgtaagcttcagactcaa
cgactggttagtgtagaacaagaagaggattatcatattgctttaatgagaataggctat
gaggtagatagtaaatcttatcagatgacgttggctatcccatttcgtatggctaatgga
ttattggcaatagtaagtcctccatataccttagcggaggatcttttccaagggaaatca
aaaagttttgaaagaaaaactgtggatcaagtcaagagtttaccgaagcaagaaatgtta
tcaatacaaaaatttttacctgtattttttgataagtatgctttaagtaatgaaatagat
ctgaagttactaatgaagcatcctgaactgatgggtggaaactatcgagtcaaatcttta
gacgctaacaatgctcggtattatcaagataaatcaaatcaagttgtgcaattaatggtt
acctttgaagatatggtaacaggaggtacacggtcagagaatttcacgctgtatctgatt
aagtcagataatggttggtatgttgacaagttgtaccattattttaaataa

DBGET integrated database retrieval system