KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1319Help
Entry
M28_Spy1319       CDS       T00263                                 

Definition
(GenBank) transcriptional regulator, Cro/CI family
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_37 HTH_26 HTH_Tnp_1_2 HTH_24 Sigma70_r4 MqsA_antitoxin YdaS_antitoxin HTH_Crp_2 Phage_CI_repr HTH_25 MarR HTH_23 Phage_CII
Motif
Other DBs
NCBI-ProteinID: AAX72429
UniProt: Q48S81
Position
complement(1300026..1300169)
Genome map
AA seq 47 aa AA seqDB search
MEKLGDRLRKQRQLNKLTQQELADRIGINRGAYSNWENGKREPSFQN
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacttggagatcgtttaagaaaacaacgacagcttaataaattaacacaacaa
gagcttgctgatagaattggtattaatagaggagcatattcaaattgggagaacggaaag
cgagaaccaagttttcaaaactaa

DBGET integrated database retrieval system