KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1321Help
Entry
M28_Spy1321       CDS       T00263                                 

Definition
(GenBank) transcriptional regulator, Cro/CI family
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_trans Rol_Rep_N HTH_3 HTH_19 HTH_31 MqsA_antitoxin HTH_26 HTH_37
Motif
Other DBs
NCBI-ProteinID: AAX72431
UniProt: Q48S79
Position
complement(1300598..1301839)
Genome map
AA seq 413 aa AA seqDB search
MNPMYLKKFRKKSGLKQKEFAKCIGISQAMLSQYESGKKKLSLEKFQEMKTHFGYLTDND
SSRLQVTIDYVRITLKSVRDLEFFCRNFLHCRFKEFSSVESKLMNYNHIWKRGDIWIFDY
ADKHDTGNYQITLQLSGQGCRQLELLMEQENFAWLDWLIYLRRSYRDEMNVTRFDLAIDE
LYLGKDRENEHFLLSDMIAKYYHHELAFESLRTWNYIGGGALNFNDMEEIEQNRQGISLY
FGSRQSEMYFNFYEKRYELAKLEGISVEESLEIFEIWNRYEIRLSQSKANAVVDEFISGI
PLGEIARGLINSKIQVYDGKNKYGAFMADQKWQMMFGGVEPLTFVTRPESYNIERTIRWL
IHQVSDSLAMVSEYDSMIDGDNLQMIINSGEVNERGEKILETIRYNLGLDKGA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaatgtatttaaagaaatttaggaagaaatcaggcttaaagcagaaagaattt
gcaaaatgtataggtattagtcaagctatgttatctcaatatgaatctggtaagaaaaaa
ttatctcttgaaaaatttcaagaaatgaaaacacattttggttatttgactgataatgat
agttcaagattacaagtgacaattgactatgtcaggattacgttaaaaagcgttagagat
ttggaatttttttgtcggaattttttacattgtcgatttaaagaattttcatcagttgaa
tctaagttgatgaattataaccatatttggaaacgtggagatatttggatatttgattat
gcagataaacatgatacaggaaactatcaaataacattacagctatctggtcaaggatgt
agacaattagaattacttatggaacaagaaaattttgcttggttagattggctaatctac
ttaagacgttcttatcgagatgaaatgaatgttacacgttttgacttagctattgatgaa
ttgtatctgggtaaggatagagaaaatgaacactttcttttatcggatatgattgccaaa
tattatcatcatgagttagcttttgaaagtttgcgaacatggaattatattggtggtggt
gctttaaattttaatgatatggaagaaattgaacagaatcgtcaaggtatttcgttatat
tttggtagtcgacagtctgaaatgtattttaacttttatgagaaaaggtatgaattagct
aaattagagggcatctctgttgaagaatctttagaaatatttgaaatatggaatcggtat
gaaatccgattatctcaatctaaggcgaatgcagtggtagatgaatttatttctggtatt
ccattaggagaaattgcgagaggattgattaatagtaaaattcaagtttatgatggaaaa
aataagtatggtgcatttatggctgatcaaaagtggcagatgatgtttggaggtgttgaa
cctctaacatttgtcacgagaccagaatcttataatattgaacgtactattcgctggttg
attcatcaagtatctgattctctagctatggttagtgaatatgacagtatgattgatggg
gataatctacaaatgatcattaattctggtgaagtgaatgaacgaggtgaaaaaatatta
gaaactattcgatataatctaggtttagataagggggcgtag

DBGET integrated database retrieval system