KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1322Help
Entry
M28_Spy1322       CDS       T00263                                 

Definition
(GenBank) FtsK/SpoIIIE family
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE DUF853 T2SSE AAA_19
Motif
Other DBs
NCBI-ProteinID: AAX72432
UniProt: Q48S78
Position
complement(1302151..1303860)
Genome map
AA seq 569 aa AA seqDB search
MRLLPEYRGIKVKPYMRYMSYYLFSFLFILFLIPVGVYSYYHLDLLKMMDKMTMIILGIS
LFLSLFVSWYLTWFLQEANPLFNKLDRLKRLAKFLFENGFVYEKRKKVNKKQKVSFPKVY
LKQGKFDLSVSFEMAGNKFQKRFKDIGGELEDTFFMDFMEKTDDPRFKIYKLAYSAFLAR
ITVNDVVWEKDKGIKLMNGYYWDFINDPHLLVAGGTGGGKTVLLRSILKCLATIGVADIC
DPKRADFVTMADLPAFRGRIVFEKVDIIAKFENAITIMYARYDFIRKEMKRLGHKDMGKF
YDYGLEPYFFICDEYNALMSSLSYQERDIVENAFTQYILLGRQVGCNAIIAMQKPSADDL
PTKIRSNMMHHISVGRLDDGGYMMLFGDENRNKEFRYIKFLSGHRVYGRGYSAVFGEVAR
EFYAPLLTKKFSFYDEFAKISRHDNPFDPLENTLVSKDIISDESLRKFVEKTSDNELPKG
SIGFDFEEEMEEINHMSIGDLAKKTGFSFGKIKNLIDMIEKDGYMTFNREDERVVLTDSD
AVILNSLLTQKDKFDGSWKELLLNYFKGE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttactgcctgaatatagagggattaaggtaaaaccatatatgaggtatatgagt
tattaccttttttcttttctatttattttgtttttgatacctgtaggggtttatagttac
taccatttagatttgttaaaaatgatggataaaatgactatgataattttagggataagt
ttgtttttatcgctttttgtttcttggtatttgacttggtttttacaagaagctaatcca
ttatttaataagttagatcgtttaaagcgtttggctaaatttttatttgaaaatggtttt
gtttatgaaaaacgtaaaaaagttaataagaagcagaaagttagttttccaaaagtttat
ttaaaacaaggtaagtttgatttaagtgtctcctttgaaatggcaggaaacaaatttcaa
aagcgtttcaaagatattggaggtgaacttgaagatactttttttatggattttatggaa
aaaactgatgatcctaggtttaagatttataaattagcttattccgcctttctggctcgt
ataacggttaatgatgttgtatgggaaaaggataaaggcattaagctgatgaatggttat
tattgggattttatcaatgatcctcatttgcttgttgcgggtgggactggtggcggtaag
actgttttgcttagatcaattttaaaatgtcttgcaactattggcgttgcggatatatgt
gatcctaagcgagctgattttgtgacaatggctgatttacctgcttttcgaggaagaatt
gtttttgaaaaagtagatattattgctaaatttgagaatgcaattacaatcatgtatgca
cgctatgactttattcgtaaggaaatgaaacgtttagggcataaagatatggggaaattt
tatgattacggattagaaccatatttttttatttgtgatgaatataatgccttgatgtct
tcgttatcgtatcaggaaagagacattgttgagaatgcctttacacagtatattctactt
ggccgtcaagtaggctgtaatgcgattattgccatgcaaaagccatccgcagatgattta
ccaacaaaaatcaggtcaaatatgatgcaccatatttctgttggtcgccttgatgatggt
ggttatatgatgctttttggggatgaaaatcggaataaagagttcaggtatattaaattt
ctatcaggtcaccgtgtgtatggtcgtggctattctgctgtttttggcgaggtagcgaga
gagttttatgctcctttgctaactaagaaattttcattttatgatgaatttgcgaaaatc
tcacgtcatgataatccatttgatccgcttgaaaatactttggtttccaaggatattatt
tcagatgaatcattgagaaaatttgtagaaaaaacgtctgacaatgagttacctaaagga
agtattggctttgattttgaagaggaaatggaggaaattaatcatatgagtattggtgat
ttagctaagaaaacaggtttttcatttggtaaaataaaaaatttaattgatatgattgaa
aaagatggttacatgacttttaatcgtgaagatgaaagagtagtattgactgattctgat
gcagttatattgaatagtttactcactcaaaaagataagtttgatggcagttggaaagag
ttgttgttgaattattttaagggtgaatag

DBGET integrated database retrieval system