KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1327Help
Entry
M28_Spy1327       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAX72437
UniProt: Q48S73
Position
complement(1311466..1311858)
Genome map
AA seq 130 aa AA seqDB search
MLNNLFIEKKGIMMSRKGVQEYDVTNVSERSIKIIKKAMYDEGTGFKPIHFYGIAICEGT
REFYRPTYPFVRSEEDLDNLKDFINLYETDLLTFYTHGHNYDFGCFIYGIGNDGKDKFRD
RWFKEGVIFY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcttaataatttatttatagaaaagaaaggtattatgatgtctaggaaaggagtacaa
gaatacgatgtaacaaatgtatctgaaagaagtataaagataattaagaaagctatgtat
gatgaaggaacaggttttaagccaattcatttttatggaatagctatctgcgaagggact
agagaattttatagacctacttatccatttgttagaagtgaagaagatttagataactta
aaagattttattaacttatatgagacagatttgttaactttttatacacatggtcataat
tatgactttggctgttttatttatggtataggaaatgacggaaaagataagttccgtgat
agatggtttaaagaaggagtcattttctattga

DBGET integrated database retrieval system