KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1328Help
Entry
M28_Spy1328       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Glutaredoxin TraF Thioredoxin_3 DUF836 Thioredoxin_8 AhpC-TSA Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: AAX72438
UniProt: Q48S72
Position
complement(1311982..1312422)
Genome map
AA seq 146 aa AA seqDB search
MEHRLSMHYFQVKKEIFGVLLLSPVILLIMWGYVSSNQDDGRLTQKQYYETVVNQTVNLV
FYKKSCPYCKVAKKEIATQAKDSQVITYYVDTSTGEGQKLVKKYHVKYAPTIVSIRKGNI
QSFLYARDRGNNIIVEKEKIKEVFSQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcgattgagtatgcactattttcaagtgaaaaaagaaatttttggggtatta
ttattgagtcccgttattttattgattatgtggggctatgtttctagcaatcaagatgat
ggtcgactaacgcaaaagcaatactatgaaacagtggtcaaccaaacggttaatttagtg
ttttataaaaagtcatgtccctattgcaaagtagctaaaaaagaaattgctactcaagct
aaggatagtcaagttattacttattatgttgatactagtacgggagaaggacaaaaattg
gttaaaaaataccatgttaagtacgcacctacaatagtatcaattagaaaaggaaatatt
caatcatttttgtatgctcgagatagaggcaacaacattatagtagaaaaagaaaagata
aaagaagtatttagtcagtaa

DBGET integrated database retrieval system