KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1329Help
Entry
M28_Spy1329       CDS       T00263                                 

Definition
(GenBank) transcriptional regulator, Cro/CI family
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_26 HTH_31 HTH_19
Motif
Other DBs
NCBI-ProteinID: AAX72439
UniProt: Q48S71
Position
complement(1312580..1313014)
Genome map
AA seq 144 aa AA seqDB search
MIDVSKKLKQLRIDRGIAKSRLITYLSITLRTYDRYEDGSRTPDLVTLMKLSDFYQCSLD
ELVKGNTNDTLVDRALIVSYRDLKDKGLNDKLAHGLVKQVYDTYEFEKIPQISDANRIKF
IYKEDLVTLLESIVSKIQEEKKCD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtatcaaaaaaactaaaacaactaagaattgatagagggattgctaaatcg
cggttgatcacttatttatcgataactttaagaacttatgacagatatgaagatggtagt
cgtactcctgatttagtaacgttaatgaaattatcggatttttatcaatgctcgcttgat
gaattagttaaagggaacacaaatgatacgcttgttgatagggcattgattgtttcgtat
agagatcttaaagataagggtttaaatgataaattggctcatggtctagtgaagcaggtc
tatgatacttatgaatttgagaagattcctcaaatatctgatgctaatagaattaagttt
atctataaagaagatttggttactttacttgaaagtatcgtgtcaaaaatacaagaggag
aagaaatgtgactag

DBGET integrated database retrieval system