KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1331Help
Entry
M28_Spy1331       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 Peptidase_M56
Motif
Other DBs
NCBI-ProteinID: AAX72441
UniProt: Q48S69
Position
1314282..1314704
Genome map
AA seq 140 aa AA seqDB search
MDLSTVIKKTEDLGITILFCNMPKTKGRYDSTLEKPCIYVDKSLSDIEKINIILHEKMHF
TKNDQSNCLSYISSYSHHIENQAEKDRILDFMNLINEEYPIDESFNYINYMKNACVPEKY
ESYIKNLAKEFYLRNHRKES
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatttatcaactgtaattaaaaaaacggaagatttaggaattactatcttattttgt
aatatgccaaaaaccaaaggaagatatgacagcacacttgaaaagccttgcatttatgtt
gacaaaagtctttcagatatagaaaaaattaacatcattcttcatgaaaaaatgcacttt
acaaaaaatgatcagagtaactgcttatcttatatttcttcatattcacatcatatcgaa
aatcaagctgaaaaagaccgcatattagattttatgaatctaattaacgaagaatatccg
attgatgaatcttttaactatatcaactatatgaaaaatgcttgtgtacctgaaaagtat
gaaagttatatcaaaaatctcgctaaagaattttatctaagaaatcacagaaaagagagc
tag

DBGET integrated database retrieval system