KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1333Help
Entry
M28_Spy1333       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin UCH_N
Motif
Other DBs
NCBI-ProteinID: AAX72443
UniProt: Q48S67
Position
complement(1315128..1315466)
Genome map
AA seq 112 aa AA seqDB search
MSDIEVYSVLVSRIEYSDGTGSKVRPAVVVKFNDEVIKTLRLTTKYENKSDNIKSQYLEV
IDWAKANLKRRSWIDTIQYYDLEDKGFNIKIIGKLSDRDIERLKDFLRAKEV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattgaggtatattctgtattagtttcacgtattgaatattctgatggtaca
ggttcaaaggttcgtcctgctgtagtagtcaaatttaatgatgaagtaataaaaacttta
agattaactactaaatatgaaaataagtctgacaatataaaaagtcagtatttagaagtt
attgattgggcaaaagcaaatttaaaaaggcgttcatggattgatacaattcagtactat
gatttagaggacaagggattcaatattaaaattattggtaagttaagtgatagagatatt
gaaagattaaaagattttctcagagcaaaggaagtttag

DBGET integrated database retrieval system