KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1334Help
Entry
M28_Spy1334       CDS       T00263                                 

Definition
(GenBank) hypothetical protein
  KO
K07473  DNA-damage-inducible protein J
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Brite
KEGG Orthology (KO) [BR:spb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:spb02048]
    M28_Spy1334
Prokaryotic defense system [BR:spb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    M28_Spy1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RelB DHOase
Motif
Other DBs
NCBI-ProteinID: AAX72444
UniProt: Q48S66
Position
complement(1315463..1315756)
Genome map
AA seq 97 aa AA seqDB search
MSTVAVRVDDQLKDDATELFQSLGLDMSTAVKMFLIQSVKTQSIPFEIKNQSSVSDEEFQ
NLVETKLKGIRVKASDPESVNAFFGDEDFSEYEEYFK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtagcagtaagagttgatgatcaattaaaagatgatgctacagaacttttt
caatccttagggttggatatgagtacagcagtaaaaatgtttttgattcagtctgttaaa
actcaaagtattccttttgaaataaaaaatcaatcatctgtttctgatgaagaatttcaa
aatttggtagaaacaaaattaaaaggaatacgagttaaggctagtgatccagaaagtgta
aatgcgttttttggagatgaagatttttcagaatatgaggaatattttaaatga

DBGET integrated database retrieval system