KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1335Help
Entry
M28_Spy1335       CDS       T00263                                 

Definition
(GenBank) transposase
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymosin
Motif
Other DBs
NCBI-ProteinID: AAX72445
UniProt: Q48S65
Position
1315777..1315962
Genome map
AA seq 61 aa AA seqDB search
MYNHCITNCNTTQTKKKIVFPSEETLEHCLVTLFNDYNFKQEQRVHKGFGHCTDTLESLF
D
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgtataaccattgtatcactaactgcaatacaacgcaaacaaaaaagaaaatcgtattt
cccagtgaagagaccctagaacactgtctagtcacactatttaatgattacaacttcaag
caagaacaacgagtccacaaaggttttggtcattgtacagacacacttgaaagcctattt
gattaa

DBGET integrated database retrieval system