KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1336Help
Entry
M28_Spy1336       CDS       T00263                                 

Definition
(GenBank) R28 protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib AlphaC_N AlphaC_C Big_4 Gram_pos_anchor YSIRK_signal I-set
Motif
Other DBs
NCBI-ProteinID: AAX72446
UniProt: Q48S64
Position
complement(1316468..1320961)
Genome map
AA seq 1497 aa AA seqDB search
MFRRSKNNSYDTSQTKQRFSIKKFKFGAASVLIGLSFLGGVTQGNLNIFEESIVAASTIP
GSAATLNTSITKNIQNGNAYIDLYDVKNGLIDPQNLIVLNPSSYSANYYIKQGAKYYSNP
SEITTTGSATITFNILDETGNPHKKADGQIDIVSVNLTIYDSTALRNRIDEVINNANDPK
WSDGSRDEVLTGLEKIKKDIDNNPKTQIDIDNKINEVNEIEKLLVVSLPDKIKYSPEAKH
RTVEQHAELDAKDSIANTDELPSNSTYNWKNGHKPDTSTSGEKDGIVEVHYPDGTVDDVN
VKVTVTSKKTDNTAPTLTVTPEQQTVKVDEDITFTVTVEDENEVELGLDDLKAKYENDII
GARVKIKYLTKEPNKKVMEVTIMKATLADKGAITFTAKDKAGNQAEPKTVTINVLPLKDS
NEPKGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGS
KDTVDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVD
TATPGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSI
GNLSDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDP
AGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDT
VDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTAT
PGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNL
SDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGK
DQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDV
TVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGD
KPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDL
PKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQT
VKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDVTVK
VVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDLPKGTTVAFEAPVDTATPGDKPA
KVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQTVKVGETPKAEDSIGNLSDLPKG
TTVAFEAPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKVVDPRTDADKNDPAGKDQTVKV
GETPKAEDSIGNLSDLPKGTTVAFETPVDTATPGDKPAKVVVTYPDGSKDTVDVTVKVVD
PRTDADKNDPAGKNQQVKGKGNKLPATGENATPFFNVAALTIISSVGLLSVSKKKED
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaggtctaaaaataacagttatgatacttcacagacgaaacaacggttttca
attaagaagttcaagtttggtgcagcttctgtactaattggtcttagttttttgggtggg
gttacacaaggtaatcttaatatttttgaagagtcaatagttgctgcatctacaattcca
gggagtgcagcgaccttaaatacaagcatcactaaaaatatacaaaacggaaatgcttac
atagatttatatgatgtaaagaatggattgattgatcctcaaaacctcattgtattaaat
ccatcaagctattcagcaaattattatatcaaacaaggtgctaaatattatagtaatccg
agtgaaattacaacaactggttcagcaactattacttttaatatacttgatgaaactgga
aatccacataaaaaagctgatggacaaattgatatagttagtgtgaatttaactatatat
gattctacagctttaagaaataggatagatgaagtaataaataatgcaaatgatcctaag
tggagtgatgggagtcgtgatgaagtcttaactggattagaaaaaataaaaaaagatatt
gataataatccaaaaacacaaatagatattgataataaaattaatgaagtcaatgaaata
gagaaattgttagttgtatcgctaccagataaaattaagtattcgccagaggctaagcat
aggactgttgaacaacacgcggaattagatgcaaaagatagcattgcaaatacagatgaa
ttgccatcaaattcaacgtataactggaaaaatggtcataaaccagacacctcaacatca
ggtgaaaaagacggaattgttgaagttcactatccagatggtactgttgatgatgtgaat
gttaaagtaaccgttacatcgaaaaaaactgataatacagctccaacattaaccgtcact
ccagagcaacagactgttaaagtggatgaagatattacctttacggttacagttgaagac
gaaaatgaagttgaactaggtttagatgatcttaaagctaagtatgaaaatgatatcatt
ggagctcgtgttaaaattaagtatcttactaaagaacctaataagaaagtcatggaagtg
acaattatgaaagctactttagcagataagggcgcaattacctttactgcaaaagataaa
gcaggtaatcaagcagaacctaagacagttaccatcaatgttcttccgcttaaggatagc
aacgaaccaaaaggtaaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagat
tctattggtaacttatcagatcttccgaaaggtacaacagtagcctttgaagctccagtt
gatacagcaacaccgggagacaaaccagcaaaagttgttgtgacttacccagatggttca
aaagatactgtagatgtgactgttaaggttgtcgatccacgtacagatgccgataagaat
gatccagcaggtaaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagattct
attggtaacttatcagatcttccgaaaggtacaacagtagcctttgaagctccagttgat
acagcaacaccgggagacaaaccagcaaaagttgttgtgacttacccagatggttcaaaa
gatactgtagatgtgacggttaaggttgtcgatccacgtacagatgccgataagaatgat
ccagcaggtaaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagattctatt
ggtaacttatcagatcttccgaaaggtacaacagtagcctttgaagctccagttgataca
gcaacaccgggagacaaaccagcaaaagttgttgtgacttacccagatggttcaaaagat
actgtagatgtgactgttaaggttgtcgatccacgtacagatgccgataagaatgatcca
gcaggtaaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagattctattggt
aacttatcagatcttccgaaaggtacaacagtagcctttgaagctccagttgatacagca
acaccgggagacaaaccagcaaaagttgttgtgacttacccagatggttcaaaagatact
gtagatgtgacggttaaggttgtcgatccacgtacagatgccgataagaatgatccagca
ggtaaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagattctattggtaac
ttatcagatcttccgaaaggtacaacagtagcctttgaagctccagttgatacagcaaca
ccgggagacaaaccagcaaaagttgttgtgacttacccagatggttcaaaagatactgta
gatgtgacggttaaggttgtcgatccacgtacagatgccgataagaatgatccagcaggt
aaggaccaaacggtcaaagtaggagaaacaccgaaggcagaagattctattggtaactta
tcagatcttccgaaaggtacaacagtagcctttgaagctccagttgatacagcaacaccg
ggagacaaaccagcaaaagttgttgtgacttacccagatggttcaaaagatactgtagat
gtgactgttaaggttgtcgatccacgtacagatgccgataagaatgatccagcaggtaag
gaccaaacggtcaaagtaggagaaacaccgaaggcagaagattctattggtaacttatca
gatcttccgaaaggtacaacagtagcctttgaagctccagttgatacagcaacaccggga
gacaaaccagcaaaagttgttgtgacttacccagatggttcaaaagatactgtagatgtg
acggttaaggttgtcgatccacgtacagatgccgataagaatgatccagcaggtaaggac
caaacggtcaaagtaggagaaacaccgaaggcagaagattctattggtaacttatcagat
cttccgaaaggtacaacagtagcctttgaagctccagttgatacagcaacaccgggagac
aaaccagcaaaagttgttgtgacttacccagatggttcaaaagatactgtagatgtgact
gttaaggttgtcgatccacgtacagatgccgataagaatgatccagcaggtaaggaccaa
acggtcaaagtaggagaaacaccgaaggcagaagattctattggtaacttatcagatctt
ccgaaaggtacaacagtagcctttgaagctccagttgatacagcaacaccgggagacaaa
ccagcaaaagttgttgtgacttacccagatggttcaaaagatactgtagatgtgacggtt
aaggttgtcgatccacgtacagatgccgataagaatgatccagcaggtaaggaccaaacg
gtcaaagtaggagaaacaccgaaggcagaagattctattggtaacttatcagatcttccg
aaaggtacaacagtagcctttgaagctccagttgatacagcaacaccgggagacaaacca
gcaaaagttgttgtgacttacccagatggttcaaaagatactgtagatgtgacggttaag
gttgtcgatccacgtacagatgccgataagaatgatccagcaggtaaggaccaaacggtc
aaagtaggagaaacaccgaaggcagaagattctattggtaacttatcagatcttccgaaa
ggtacaacagtagcctttgaagctccagttgatacagcaacaccgggagacaaaccagca
aaagttgttgtgacttacccagatggttcaaaagatactgtagatgtgactgttaaggtt
gtcgatccacgtacagatgccgataagaatgatccagcaggtaaggaccaaacggtcaaa
gtaggagaaacaccgaaggcagaagattctattggtaacttatcagatcttccgaaaggt
acaacagtagcctttgaagctccagttgatacagcaacaccgggagacaaaccagcaaaa
gttgttgtgacttacccagatggttcaaaagatactgtagatgtgacggttaaggttgtc
gatccacgtacagatgccgataagaatgatccagcaggtaaggaccaaacggtcaaagta
ggagaaacaccgaaggcagaagattctattggtaacttatcagatcttccgaaaggtaca
acagtagcctttgaaactccagttgatacagcaacaccgggagacaaaccagcaaaagtt
gttgtgacttacccagatggttcaaaagatactgtagatgtgacggttaaggttgtcgat
ccacgtacagatgccgataagaatgatccagcaggtaaaaatcagcaagtcaaaggtaaa
ggaaataaactaccagcaacaggtgagaatgcaactccattctttaatgttgcagctttg
acaattatatcatcagttggtttattatctgtttctaagaaaaaagaggattaa

DBGET integrated database retrieval system