KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1337Help
Entry
M28_Spy1337       CDS       T00263                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC Sigma70_r3
Motif
Other DBs
NCBI-ProteinID: AAX72447
UniProt: Q48S63
Position
1321190..1322395
Genome map
AA seq 401 aa AA seqDB search
MVTHMIDSLLLKSLHSLLGLTITVCDQNFSVIREYKSDKTISLFYNHYLILSNFSKTQHD
FLFHYGSLGELFLVHHIQQYYIIIGPWRSNAIDPLLLKKKLTETQINASEQDYFIDRLSQ
LPFFSLSQIRELLIVTNYCLTGVVKDKLSEPLHYYTKGWSNSFDLDKIKQFSKQNMSSYK
YQYHFENNILKAVKSGSEFLLKETVEHFSNSIVPIISGDELRSEKNYSIIIYDRLSQATI
QAGLDIETAYRARDRFIKETESTISLNEVLKLRDTAILFYTQQVDSLKRHLETPHSQTIV
AVIRYLENNLNRFIKTEEIAKECHMSESKLRKLFKQEKHITIQQYFINLKIEAAKQLLDE
NKKVEEVSNLLGFSTSSNFSRTFKKIVGISPLEYKQKLKTI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactcatatgattgattctttattgttgaaatcattacacagtcttctaggtcta
actattactgtttgtgatcaaaatttttctgttatcagagagtataaatccgataaaact
atttcacttttttacaatcattaccttattttaagtaactttagtaaaactcaacatgat
tttttatttcattatggctctttaggagaactttttcttgtccaccatattcaacaatat
tatattatcatcggtccctggcgtagcaatgctattgatcctttacttcttaagaaaaag
ctgactgaaacacaaatcaatgctagtgaacaagactactttattgatagactatcccaa
ttacctttcttctcacttagtcaaatccgagaattactaatagtaaccaattattgtcta
actggggttgtgaaagataaattatcagagcccttacattactacacgaaagggtggagc
aactcctttgatctagataaaattaagcaattttctaaacagaatatgagttcttacaaa
tatcagtatcattttgaaaataatattctaaaagctgttaaatcaggtagtgaatttctt
ttgaaagaaacagtggaacactttagcaattctatcgtacctataatcagtggagatgaa
ttgcgatctgaaaaaaactactccatcattatttatgatcgtctctcacaggctaccatc
caagcaggacttgatatcgaaacagcttatcgagcacgagatcgttttataaaagaaacc
gagtcaactataagtctaaatgaagttttaaaattacgtgatactgctatcttattctat
actcaacaagttgattctttaaaaagacatctcgaaacccctcattctcaaactattgtc
gcagtgattcgatatcttgaaaataatctaaatcgctttattaaaacagaagaaatagct
aaagaatgtcacatgagtgaatcgaagttacgaaaactatttaagcaagaaaaacacatc
actattcaacaatattttataaacttaaaaatcgaagctgctaagcagttactagacgaa
aataagaaagtagaagaagtttccaatttacttggattttccacttcttctaatttttca
aggacatttaaaaaaatagtgggaattagcccactagaatataagcaaaagcttaagaca
atatag

DBGET integrated database retrieval system