KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1352Help
Entry
M28_Spy1352       CDS       T00263                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00010  Glycolysis / Gluconeogenesis
spb00052  Galactose metabolism
spb00500  Starch and sucrose metabolism
spb00520  Amino sugar and nucleotide sugar metabolism
spb00521  Streptomycin biosynthesis
spb01100  Metabolic pathways
spb01110  Biosynthesis of secondary metabolites
spb01120  Microbial metabolism in diverse environments
spb01130  Biosynthesis of antibiotics
spb01200  Carbon metabolism
Module
spb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M28_Spy1352
   00052 Galactose metabolism
    M28_Spy1352
   00500 Starch and sucrose metabolism
    M28_Spy1352
   00520 Amino sugar and nucleotide sugar metabolism
    M28_Spy1352
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M28_Spy1352
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    M28_Spy1352
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M28_Spy1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AAX72462
UniProt: Q48S48
Position
1339058..1339981
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCIDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAISSPGAINKEKGVIEGASAIPYIHHFKIQEALEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDHLALKERQVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactataataaaggagaacacctcatgagcttgttatgt
attgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccatcagttcacctggggcaatc
aataaagaaaagggggttatcgaaggcgccagcgctattccctacattcaccattttaaa
atacaagaggccttagaagaacggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccacctagcactc
aaagaaaggcaggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagctatttgtcactttaaaaacgaagccaatcttcttggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system