KEGG   Shewanella putrefaciens CN-32: Sputcn32_1386Help
Entry
Sputcn32_1386     CDS       T00513                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00360  Phenylalanine metabolism
spc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spc00790  Folate biosynthesis
spc01100  Metabolic pathways
spc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Sputcn32_1386
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sputcn32_1386
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputcn32_1386
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Sputcn32_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ABP75113
UniProt: A4Y580
Position
1574132..1574932
Genome map
AA seq 266 aa AA seqDB search
MTKGTTYIARKADDTGYIDYSQEEHDIWSQLYARQAVNLPGRACLEYLNGLDALAMPKDR
IPQLAEVDLVLQATTGWKTAAVPALISFGHFFELLANKAFPVATFIRRKEEFDYLQEPDI
FHEIFGHCPLLTNPSFANFSHMYGQLGLNASKEERIFLARLYWFTVEFGLLQPKEGPLCI
YGGGILSSPGETLYAMESEVPERRSFDLLDVLRTPYRIDIMQPIYYVIEHIEMLDDIAKM
DIMSYVTKARQLGLFPPKYPPKAKAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggaaccacctacatcgcccgcaaggctgatgacactgggtatatagattac
tcgcaagaagagcatgatatttggagccaactttacgcccgccaagcggttaatctccct
ggccgagcttgtctagaataccttaacggactcgatgcgttagcgatgccaaaggatcgt
attccacaactcgctgaagttgatcttgtattacaggcaacaacaggctggaaaacggca
gcagtacccgcactaatatcattcggccacttttttgaactcttagcgaataaagcgttt
ccagtggcgacattcattcgccgtaaggaagagtttgattacctgcaagaaccagatatt
tttcacgaaatttttggtcattgccctttgcttaccaatccttcatttgccaatttttcg
catatgtatggccaattgggtttaaatgctagcaaagaagaacggatatttttagcgcgt
ttatactggtttaccgttgagtttggcttacttcaaccaaaagagggccccttatgtatc
tatggcggtggcattttaagttcacccggtgaaaccctatatgcaatggagagcgaagta
cccgaacgtaggtcctttgatttactggatgtgctgcgcacaccttaccgaatcgatatt
atgcaaccgatttactatgtgattgagcatattgagatgttggatgacattgccaaaatg
gacattatgagttatgtcactaaggctcgtcagttaggtttatttccccctaaatatcct
ccgaaagcgaaggcgagttaa

DBGET integrated database retrieval system