KEGG   Shewanella putrefaciens CN-32: Sputcn32_1397Help
Entry
Sputcn32_1397     CDS       T00513                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00071  Fatty acid degradation
spc00072  Synthesis and degradation of ketone bodies
spc00280  Valine, leucine and isoleucine degradation
spc00310  Lysine degradation
spc00362  Benzoate degradation
spc00380  Tryptophan metabolism
spc00620  Pyruvate metabolism
spc00630  Glyoxylate and dicarboxylate metabolism
spc00640  Propanoate metabolism
spc00650  Butanoate metabolism
spc00900  Terpenoid backbone biosynthesis
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc01130  Biosynthesis of antibiotics
spc01200  Carbon metabolism
spc01212  Fatty acid metabolism
spc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sputcn32_1397
   00630 Glyoxylate and dicarboxylate metabolism
    Sputcn32_1397
   00640 Propanoate metabolism
    Sputcn32_1397
   00650 Butanoate metabolism
    Sputcn32_1397
  Lipid metabolism
   00071 Fatty acid degradation
    Sputcn32_1397
   00072 Synthesis and degradation of ketone bodies
    Sputcn32_1397
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sputcn32_1397
   00310 Lysine degradation
    Sputcn32_1397
   00380 Tryptophan metabolism
    Sputcn32_1397
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sputcn32_1397
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sputcn32_1397
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sputcn32_1397
Enzymes [BR:spc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sputcn32_1397
Exosome [BR:spc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sputcn32_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABP75124
UniProt: A4Y591
Position
1585513..1586703
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQEIVIVAAKRTPMGGFQGSLSSVASPTLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKMLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKAEITPVTVSDRRGDVTVDIDEQPGNARPEKIPTLRPAF
SKDGTITAANSSSISDGAAALMLTSRGEAERLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSMDEVDLFEINEAFAMVTMLAVSELGLDVAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagagatcgttattgttgccgctaaacgcacccctatg
ggtggttttcaaggcagtttgtcatctgttgcatcaccgactctagccgcgacagccatt
aagggcttgttggcggagactcaattggcgggtgagcatgtcgatgaagtcttgatgggc
tgtgtattacccgcaggtttaggtcaagcgcctgcgcgtcaggcaactttaggtgcgggg
ctaccactttcagtgggggcgactactgtgaacaaagtatgcggttcaggcatgaagacg
gtcatgttagcccatgacttgattaaagcgggcagtgcaaaagtggtgatcgctggcggt
atggaaagcatgagccaagcgccgtatctattggataaagcccgcggcggcatgcgtatg
ggccacggcaaaatgctcgaccatatgtttttagacggtcttgaagatgcctacacgggt
ggcgctatgggaacgtttgcccagaaaaccgccgatgaatttggtattacccgcgagcag
atggatgctttcgccctaagctcgctcgaaaaagccaatgcggcgattaactcgggcgcc
tttaaggccgaaattaccccagtcacagttagtgatcgtcgcggtgatgtgactgtcgac
atcgacgagcaacccggtaatgctcgaccagaaaaaattcctacgctgcgcccagctttt
agcaaagatggcactatcacagcggctaactctagctcgatttccgatggcgcagcggca
ttgatgctgacctctcgcggcgaagctgagcgtttaggcttaactgtattagccaccatc
aaaggccacacgacccacgcccaagagccttcactctttaccactgcacctgtcggcgct
atggcgaaattactggccaatgtcggttggtcaatggatgaagtcgatttattcgaaatc
aatgaagccttcgccatggtgactatgcttgccgtgtctgaactgggtttagatgtggct
aaggttaacgtcaatggcggcgcttgcgctttaggtcatcctattggctgttctggttca
cgtttactagtgaccttaatccatgctttaaaagcccgaggccttaaacgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggcgattgaggtttaa

DBGET integrated database retrieval system