KEGG   Shewanella putrefaciens CN-32: Sputcn32_1571Help
Entry
Sputcn32_1571     CDS       T00513                                 

Definition
(GenBank) rRNA (guanine-N(1)-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
spc  Shewanella putrefaciens CN-32
Brite
KEGG Orthology (KO) [BR:spc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spc03009]
    Sputcn32_1571
Enzymes [BR:spc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Sputcn32_1571
Ribosome biogenesis [BR:spc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Sputcn32_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_32 Methyltransf_12 Methyltransf_23 MTS Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABP75296
UniProt: A4Y5R3
Position
1788167..1788982
Genome map
AA seq 271 aa AA seqDB search
MRYLCPLCSGLLARAGASWVCPQQHKFDIAKEGYVNLLPVQKKNSKDPGDNKQMMFARRE
FLNAGYYQMLSDRVNALALEYAAGAKHILDIGCGEGYYSHRLFHVFEQDHPCVLQGLDIS
KSAIKYAAKRYPNLQFCVASAYEMPIASQTVDLAIRIYAPSKVEELQRIMAKNGVLITVS
PGPMHHFALKQQIYAEPRLHPESNASLEGFECIHQQRLMSQLGLKNAEHISHFLEMTPYA
WKFTTEQKQSLVTQGLSCELDFQIEVYRIAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttatgtccactttgttccggattacttgcccgtgccggagctagttgggtg
tgcccacagcaacataagttcgatatagccaaagaaggctatgttaacttgctgcctgta
caaaagaaaaactcaaaagatcctggcgataacaaacagatgatgtttgctaggcgggag
tttttaaacgcaggatactaccaaatgttgagcgatagagtgaatgcattggcattggaa
tatgctgcaggagcaaaacatattttggatataggctgtggagaaggttattacagtcat
agattatttcacgtatttgagcaggaccacccgtgtgttttacagggattggatatttct
aaatcggcaatcaaatatgctgcaaaacggtatcctaacttacaattttgtgtggcaagt
gcttatgagatgccgattgcttcacaaacggtggatttagccatacgtatttatgcgcct
tctaaagtagaagaacttcagcggatcatggctaaaaatggtgtattaatcactgtttca
ccggggccaatgcaccattttgcccttaaacagcaaatttacgctgaaccaaggttacat
ccagagtctaatgcgagtcttgaaggatttgaatgtattcatcagcaacgactgatgtca
caactgggattaaaaaatgccgagcatatttcacattttctagagatgacgccctatgca
tggaagtttactacagagcagaagcaatctttggtaacacaagggctaagttgtgagtta
gattttcaaattgaggtttatcgtattgcaagatag

DBGET integrated database retrieval system