KEGG   Shewanella putrefaciens CN-32: Sputcn32_2060Help
Entry
Sputcn32_2060     CDS       T00513                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00010  Glycolysis / Gluconeogenesis
spc00052  Galactose metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sputcn32_2060
   00052 Galactose metabolism
    Sputcn32_2060
Enzymes [BR:spc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sputcn32_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABP75781
UniProt: A4Y748
Position
complement(2354124..2355179)
Genome map
AA seq 351 aa AA seqDB search
MSLSISTQKLTHSAFPAPLELITLTNSHGLEVVLSSYGASIWSVKLYGKEDKTIDLSLSY
QNIQDWAINPYYFGITAGRVANRIGGAAFSLKGQTIVLTPNEGNNQLHGGPQGLSHCVWQ
CETKQYSDAVGAIFRIQSPDGDQGYPGDLSVTVEYRLSESNELTLIYDALSDQTTPVCLT
NHAYWNLASDKQHGILGHNLQLNASHILALDSEQIPTGELVLVDDTPFDFRQIKSISEDI
HKLSNGYDHYFVMSKDIDNTSCLKTIATLIEPISGRELEISTTELGVQFYSGNFLDGTRL
DNHGKPLNQYQGLCLETHGYPNAVNIAHFPSVMLEANKPYKQITVHRFKNI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctcaatctctacacaaaaattaacacatagtgcctttcctgcaccattagag
ttaataacattaacgaatagtcatggtttggaagtagtgttatcgagttatggtgcaagt
atttggtctgtcaaactctatggaaaagaagataaaaccattgatctcagtttgagttat
cagaatattcaagattgggcaataaatccttattattttggtattactgcaggccgcgtt
gcaaatcgaattggtggagcggcattttctttaaagggtcaaaccattgtattaaccccg
aatgaaggtaataaccaacttcacggtggtccgcaaggcttaagtcactgtgtttggcaa
tgtgaaactaagcaatattccgatgctgttggtgccatctttagaatacagagtcctgat
ggtgatcaaggttatcctggggatttatccgtaacagtcgaatatcgccttagcgaaagc
aatgagttgaccctaatttacgatgcactctctgaccaaaccactccggtttgtctcaca
aatcatgcctattggaatctcgcatctgacaagcaacatggcatcttaggccataactta
caactcaatgcgagtcatattttagccttagattctgagcaaattcctacgggtgaattg
gttttagtcgatgatacccccttcgattttcgtcaaataaaatccatatctgaagatatt
cataaattaagtaatggttatgaccactattttgtgatgtcgaaggatatagacaatacc
tcatgcttaaaaaccatcgccacattaatcgaacctatttcaggacgtgaattggaaatc
agtaccacagaattaggcgtgcaattttatagtggtaattttttggatggtacgcggctt
gataatcatggaaaaccgttaaatcaatatcaaggtttatgtttagaaacccatggttat
cctaatgccgtcaatattgctcattttccgagtgttatgttagaggcaaataaaccctat
aaacaaataacggtgcatagatttaaaaatatttaa

DBGET integrated database retrieval system