KEGG   Shewanella putrefaciens CN-32: Sputcn32_2080Help
Entry
Sputcn32_2080     CDS       T00513                                 

Definition
(GenBank) glycosyl transferase, family 2
  KO
K03669  membrane glycosyltransferase [EC:2.4.1.-]
Organism
spc  Shewanella putrefaciens CN-32
Brite
KEGG Orthology (KO) [BR:spc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spc01003]
    Sputcn32_2080
Enzymes [BR:spc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Sputcn32_2080
Glycosyltransferases [BR:spc01003]
 Polysaccharide
  Bacterial polysaccharide
   Sputcn32_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_2_3 Glyco_transf_21 Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABP75801
UniProt: A4Y768
Position
complement(2381039..2383222)
Genome map
AA seq 727 aa AA seqDB search
MTVSENSVLETEVLVGGSAMPNERPGAMEPQSLTEMPEGFPRRSTVANGVRSRSSRRFFV
VGGALLLSSFAIYEMGAVFSIGGITPLEYLVLLLFAINFCWIALAFCSGIAGFLILLRKP
KAKDLEVTELHTRTAILMPTYNESPDRVFSAVSVMAEALSQTGHGHAFDWFILSDTTDPE
IALLEEQAFLVLRQETHKHSRVYYRRRRKNVARKAGNVADFCRRWGSRYDHLLVLDADSL
MESSTITGLAQRMQADPDAGLIQTIPSLINGTTLMARLQQFAARIYGPVIGTGLGWWVQK
EGNFWGHNAIIRTEAFMGAAGLPNLKGKPPFGGHILSHDFVEAALIRRAGWSVVIAYDLP
GSYEECPPSIVDLAVRDRRWCQGNLQHSRILPTKGLHWVSRLHLLTGIMAYLSSPFWLLL
ILTGLMLALQAHFIRPEYFTDQFSLFPTWPIMDSDRALRLFYITMGVLFGPKIFGVLLLL
KDGQFARSVGGRIKAIFSVLFEVVLSALIAPIMMFIHCGAVMSILMGRDSGWSPQRRDDG
SMPWLTLIYRHRWHMLAGVMLGYAAILDSLTLLAWMSPALIGLWFAVPISAWTGSVKIGE
VFKRAGILATPEERSPAAICLQAQDARAAYQAHISKPWTLAQLLKDPALMELHLAMVDKQ
PLRAAGTPIEPVEAIVHVKVHEAQCQESAMALFNRQEMALVLANPLMLRSLQKLPEQFVA
EDLVSFC
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatccgagaattcggtactcgagactgaagtgctcgtgggcggtagtgccatg
ccaaatgaaaggcctggcgctatggagccacaaagtttaactgaaatgccagagggtttt
cctcgccgcagtactgtggctaatggtgttcgttcacgttcttctaggcgtttctttgtt
gttggtggtgcgctgttactttcctcatttgcaatttatgaaatgggtgcagtattcagt
atcggtgggatcacgcctctggaatacttggtgctgttgctttttgcgatcaacttctgt
tggattgcgctggcattttgcagtggtattgctggttttttaattttattgagaaaaccc
aaagcaaaagatttggaagtgaccgagttacatactcgcactgcgattctaatgcccacc
tataatgaatcccctgatcgggtgttttctgccgtgtctgtgatggctgaagccttatca
cagacagggcatggtcatgccttcgattggtttattttaagtgatacaaccgatccagaa
attgcactgttagaagaacaggcatttttggtgttgcgccaagagactcataaacattcc
cgtgtatattaccgtcgccgtcgtaaaaacgtggctcgtaaagcgggtaatgtcgcggac
ttttgtcgccgctggggctcgcgttatgatcacttattagtgctcgatgcggatagctta
atggagtcttcgaccatcacaggtcttgcccagcgaatgcaggcggatcctgatgctggg
cttatccaaaccataccttcgcttatcaatggtacgaccttgatggctcgtttgcagcaa
tttgcggcgcgtatttatggtcctgtaattggtactggtttaggttggtgggtacaaaaa
gaagggaacttctggggccacaatgcgattattcgcaccgaagcatttatgggggcagcg
ggcttaccaaatctgaaaggtaagccgccttttggtggtcacatactaagccatgacttt
gttgaagctgcacttatccgccgcgcgggttggagtgtggtgatagcctatgatttgcct
ggttcatatgaggaatgtccaccatcaatcgttgatttagcggtacgggatcgtcgttgg
tgtcagggtaatttacagcattcgcgtatcttgccgaccaaaggtttgcactgggtcagc
cgtttacatttgttgacgggaattatggcgtatttatcatcgccattttggttattgttg
atcttaacgggcttaatgcttgccttgcaggcgcactttatcagacctgaatatttcacc
gatcagttttctttgttccctacatggccaatcatggactccgatagggcattgagatta
ttttacatcactatgggtgtactgtttgggcccaaaatatttggggtattactgctactc
aaagatggtcagtttgcgcgcagtgtgggcggccgtatcaaagccattttcagtgtgttg
tttgaagttgtgctttccgcattaatcgcacctattatgatgtttattcactgtggtgct
gtgatgtccattctgatggggcgtgatagcggctggtcgcctcagcgacgcgatgatggc
agtatgccttggttaacgcttatttatcgtcaccgttggcatatgctcgcaggggtgatg
ttaggttatgccgccattttggactcattaactttgcttgcgtggatgagcccagccctg
attggtttatggtttgcagtgcctatctcggcttggacagggtcagtcaaaattggtgaa
gtgtttaagcgagcgggtattttagctacgccagaagaacgtagtcctgcggcaatttgt
ttgcaggctcaggatgcgcgtgcagcctatcaagcacatatctctaaaccttggacatta
gcacagttattgaaagatccagcgttaatggagttgcatttagcaatggtggataaacaa
ccactgcgtgcggcgggaacgcctattgagccggtcgaagctattgtgcatgttaaggtg
catgaagcgcagtgccaagaaagtgcgatggcattatttaaccgtcaagaaatggcatta
gtcttagccaatccattgatgcttcgcagcttacaaaagttacctgagcagtttgtggca
gaggatttagtgtctttttgctag

DBGET integrated database retrieval system