KEGG   Shewanella putrefaciens CN-32: Sputcn32_2141Help
Entry
Sputcn32_2141     CDS       T00513                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00230  Purine metabolism
spc00240  Pyrimidine metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
Module
spc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
spc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
spc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
spc_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sputcn32_2141
   00240 Pyrimidine metabolism
    Sputcn32_2141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spc04131]
    Sputcn32_2141
Enzymes [BR:spc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Sputcn32_2141
Membrane trafficking [BR:spc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Sputcn32_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABP75862
UniProt: A4Y7C9
Position
complement(2458789..2459220)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVAAKMLHLTKEQAEGFYAEHSERGFF
GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD
AVESAAREIAYFFSAEELCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcacattttctattatcaaaccagatgctgttgcaaaaaaccacatc
ggtgctatctacaatcgttttgaaactgcaggtcttaagatcgttgcggctaaaatgtta
cacctgactaaagaacaagctgaaggtttctatgcagagcatagcgaacgcggtttcttt
ggtgctctggttgcatttatgacttctggcccaattatggtccaagtattagaaggcgaa
aacgctgttttagctcaccgtgaaattttaggtgcaactaacccagctcaagctgctcct
ggtactatccgtgctgatttcgctgaaagcatcgacgaaaacgctgcacacggttcagac
gctgttgaatctgctgctcgtgaaattgcttacttcttcagtgctgaagaactgtgtcca
cgtactcgttaa

DBGET integrated database retrieval system