KEGG   Shewanella putrefaciens CN-32: Sputcn32_2349Help
Entry
Sputcn32_2349     CDS       T00513                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00010  Glycolysis / Gluconeogenesis
spc00620  Pyruvate metabolism
spc00640  Propanoate metabolism
spc00680  Methane metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc01130  Biosynthesis of antibiotics
spc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sputcn32_2349
   00620 Pyruvate metabolism
    Sputcn32_2349
   00640 Propanoate metabolism
    Sputcn32_2349
  Energy metabolism
   00680 Methane metabolism
    Sputcn32_2349
Enzymes [BR:spc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sputcn32_2349
Lipid biosynthesis proteins [BR:spc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sputcn32_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP76070
UniProt: A4Y7Y7
Position
2706818..2708770
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNEQYKTMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLSEHSDRVAIIWEGDNASEQRKITYGELHADVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVVITSDEGMRGGRAIPLKRNIDDALNHPDVTSVEKVIVLKRTGGKIDWVEGRDVWWHSL
LETASEHCQPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKAGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTL
IRALMAEGKQHFDQFDGSTLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGENEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEESEELRQELRQWVRKEIGALATPDLIQWAS
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRTE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaat
aacgaacaatataaaacaatgtaccaagagtcgattgtcaacccagagggtttctggaga
gagcacggcaaacgcattgactggataaaaccctatacaaagatcaaaaaaacctctttt
gacgatcataatttgtcgattaactggttttacgatggcaccctaaacgcatcagctaac
tgccttgaccgccaccttagcgaacacagtgatcgcgtggcgattatttgggaaggcgac
aacgccagcgaacaacgcaaaatcacctacggtgaattacatgcagatgtgtgtaagttt
gccaacgcactgcgtagtcaaggcgtgcgccgtggtgacatagtcaccatttacatgcca
atggtgccagaagccgccgttgctatgcttgcttgcgcacgcattggcgcggttcattca
gtcgtatttggtggcttctcacctgactctatcgcctcccgtgtgatcgatggcaaatca
aaagtggtgatcacctctgatgaggggatgcgcggtggccgagccattccgctaaagcgt
aatatcgatgacgcgctcaatcatcccgatgtcactagcgtagaaaaagtcattgtactt
aaacgtacaggtggcaaaatcgactgggttgaaggccgtgatgtttggtggcacagctta
cttgaaaccgcatcggagcactgccagccagaagaaatgggcgccgaagacccactgttt
ttactctatacctcaggctctaccggtaatcctaaaggtgttttacataccactggtggt
tacatggtttatgcgtcgatgacccatgaatatgtctttgattataaagcaggagaagtg
tactggtgtacggctgatgtaggttggatcacgggccactcatatatggtttacggtcca
ctcgccaatggtgccactgtacttatccatgaaggcgtgcccaatcatccaagccccgct
cgacttggtgagatgattgaccgtcataaggtcaatatcctttacaccgcaccgacgttg
atccgtgcattaatggccgaaggcaaacagcattttgatcaattcgatggaagtacactg
cggatcatgggctcagttggcgaacctatcaatccagaagcatggcgttggtatcacgaa
gtcattggtcacgagcattgtccgattgtcgatacttggtggcaaaccgagactggcggt
attttaataacgccactgccgggtgcgacggacacaaaaccgggatcagccacccgtcca
ttctttggcgtacaacccgccctagtagacaatatgggtaacattttagagggtgagaat
gaaggtaacttagttttactcgattcttggccaggccaaatgcggactgtgtatggcgat
cacgaacgattcgtgctgacctactttaaaaccttccgcggcatgtattttaccggtgat
ggtgcccgtcgcgatgaagacggttactactggatcacggggcgtgtcgatgacgtcatt
aacgtctctggacaccgtttaggtaccgctgaagtggaaagtgcattggtatcccatgaa
ctggttgctgaagccgctgttgtgggctatccacacgatattaaaggccaaggtatctat
gcctacgtcacgctaacccgtggaacagaagaaagtgaagagctacgccaggaactgcgc
caatgggtgcgtaaagagattggtgcattagcaactccagacctcatccaatgggcaagt
ggattacctaaaacccgttcaggcaaaattatgcgccgcttcctacgtaagattgctgct
aacgaagtcaccaacttaggtgatgcatcaaccttagccgatccagcggttatcgaaacc
ttgattgaaacccgtttaaatcgtacagaataa

DBGET integrated database retrieval system