KEGG   Shewanella putrefaciens CN-32: Sputcn32_2537Help
Entry
Sputcn32_2537     CDS       T00513                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00521  Streptomycin biosynthesis
spc00523  Polyketide sugar unit biosynthesis
spc01130  Biosynthesis of antibiotics
Module
spc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sputcn32_2537
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sputcn32_2537
Enzymes [BR:spc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sputcn32_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABP76258
UniProt: A4Y8H5
Position
complement(2954600..2955148)
Genome map
AA seq 182 aa AA seqDB search
MKIIDTKIPDVKIIEPKVFGDERGFFFESFNQQQFEAAVGYSVKFVQDNHSKSSKGVLRG
LHYQLPPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGQWVGIHLSAENKRQLWIPSGFAHG
FVTLTETAEFLYKTTNFYAPQSEGSICWDDTDIGIEWPLVDKPSLSSKDQMSSLLINATT
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgatacaaaaattccagacgtaaaaattattgaacctaaagtatttggt
gatgagcgcggttttttctttgaaagctttaatcagcagcaatttgaagcagcagtaggc
tattcagtcaaattcgtccaggacaatcactccaaatctagcaaaggggtattacgtggg
ttgcactatcaattacctccttatgctcaaggtaagttagtacgttgtgtggtaggtgag
gtcttcgatgtggctgtagatattcgcaaaagttcaccaacttttggtcagtgggtgggt
atacatttatctgcggaaaataaacgccaattatggatcccttcgggatttgcacatgga
tttgttactttaactgaaacagcagaatttttgtataagacaactaatttctatgcaccg
cagagtgaaggttcaatatgttgggatgatactgatatcggaattgaatggcctttagta
gataaacctagtttgtcatcaaaagaccaaatgtcctcgttgttgatcaatgcaacaaca
tttgaataa

DBGET integrated database retrieval system