KEGG   Shewanella putrefaciens CN-32: Sputcn32_2821Help
Entry
Sputcn32_2821     CDS       T00513                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00240  Pyrimidine metabolism
spc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sputcn32_2821
Enzymes [BR:spc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sputcn32_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABP76540
UniProt: A4Y9A7
Position
complement(3277067..3278398)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSPAEIQFFVQGITTNAVSEGQIAAFGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNETEARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADAKGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKIDSSTPIAVIHAQSEAAFTEAENAVKKA
IHIGETAPEKTPEIYAYIRAADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagtcctgca
gaaatacagttttttgtccaaggtatcactactaacgcagtatccgaaggccagatcgct
gcattcggtatggcagtgtactttaatgacatgaatatggatgaaagaatcgctttgacg
acggcaatgcgtgattctggcactgtacttaattggcaatcattgggactcaatggccct
gttatcgacaaacacagcactggcggtgtgggcgatgtgattagccttatgcttggccct
atggctgcggcttgtggtggttatgtgccgatgatttcaggacgtggcctaggccatacg
ggcggcacgctcgataagtttgatgcgattccaggttatcaaactgagccatcaagcgaa
ctatttcgcaaagtcgttaaagaggtcggtgtcgccattattggtcagacaggtgatctc
gttcctgccgataaacgcttctattctatccgtgataataccgctaccgttgaatctatt
tccctcatcacagcgtcgattctgtctaagaaattagcctgcaatttagatgcactcgct
atggatgtaaaagtcggtagtggcgcttttatgcctacctatgaggcttctgaagagtta
gcgcgcagtattactgctgtagccaatggtgcgggaactaagaccacagcattacttacc
gacatgaaccaagtgctagcctcctgtgccggtaacgcggttgaagtgaaagaagccatt
gacttcttaacaggtgcttaccgtaacccacgtctatatgaagtgactatgggcctttgt
gctgagatgttgctccttggcggtcttgcaagcaatgaaactgaggctcgcgctaaactc
aatcgtgtgctcgataacggccgtgccgctgaaatttttggcaagatggtctcagggctt
ggtgggccagtcgattttgttgaaaactacagtaagtacctaccgcaatcacagattatt
cgccctgtatttgccgatgcaaagggttatgcctatagcatggatacccgagagcttggt
ttagccgtggtgactctcggtggtggccgcagaaagcctggcgatgcactagactatagt
gttggtttaacccaagtctgtgcccttggtgataaaattgattcatcaacgcctattgct
gttatccacgcacagtctgaagcagcctttacagaagcggaaaatgcggtgaaaaaagcg
attcacataggtgaaaccgctccagaaaaaacacctgagatctacgcttacattcgtgca
gcggatctttaa

DBGET integrated database retrieval system