KEGG   Shewanella putrefaciens CN-32: Sputcn32_3162Help
Entry
Sputcn32_3162     CDS       T00513                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00270  Cysteine and methionine metabolism
spc00480  Glutathione metabolism
spc01100  Metabolic pathways
Module
spc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sputcn32_3162
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sputcn32_3162
Enzymes [BR:spc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Sputcn32_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABP76874
UniProt: A4YA91
Position
3680838..3681791
Genome map
AA seq 317 aa AA seqDB search
MIKLGIVMDPISEINIKKDSSFAMLMAAQERGYQLFYMEMADLAMVNGVAMANMRPLTVF
NDASKWFELGEATDTPMSELDVILMRKDPPFDTEFIYATYMLERAEEQGVLIVNKPQSLR
DANEKLFTAWFSEFTPETIVTRDAKRIRAFHQAKGDIILKPLDGMGGTSIFRVKQDDPNL
GVIIETLTSYGQQYAMAQAFIPEITQGDKRILVVDGEPVPYALARIPMKGETRGNLAAGG
SGVAQPLSDSDWAIARAIGPELKKRGLIFVGLDVIGDKLTEINVTSPTCIREIQAAFDVD
ITGMLMDAIEARVKASA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactcggcatagtgatggaccccatcagtgagatcaacattaagaaagactcc
agttttgccatgttaatggccgcgcaggaaagaggttatcagctgttttatatggaaatg
gccgatcttgccatggtcaacggtgtggctatggccaatatgcgcccgttaactgttttc
aatgatgcaagcaaatggtttgaactcggcgaagctacagacacgccgatgagcgaactc
gacgtgatcctaatgcgtaaggacccgccattcgatactgagtttatctacgcaacttac
atgcttgaacgcgccgaagaacaaggcgtattgatcgttaacaagccacaaagtttgcgt
gatgctaacgaaaaactgtttaccgcctggtttagcgaattcactccagaaacgatcgta
acccgtgatgccaaacgtatccgcgctttccaccaagcgaagggcgatattattcttaag
cctttagatggcatgggtggcacctcgattttccgcgtgaagcaggatgacccaaacctt
ggtgtcatcatcgaaaccttgaccagttatggtcaacaatatgcgatggcgcaagccttt
atccctgagataacccaaggcgataaacgcattttagtggtcgatggtgagccagtgcct
tacgccttggcgcgtatcccaatgaaaggcgaaacccgtggtaacttagctgctggcggt
agcggtgtagcccagcctttatccgacagcgattgggcgattgcccgtgccattggtcct
gagcttaaaaaacgtggactgatttttgtcgggctagatgtcattggtgacaagctgact
gagatcaacgtgactagcccaacctgtatccgtgaaatccaagcggcatttgatgtcgac
atcacaggtatgttaatggatgctattgaggcgcgcgttaaagcctcagcttga

DBGET integrated database retrieval system