KEGG   Shewanella putrefaciens CN-32: Sputcn32_3556Help
Entry
Sputcn32_3556     CDS       T00513                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00230  Purine metabolism
spc00240  Pyrimidine metabolism
spc00760  Nicotinate and nicotinamide metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sputcn32_3556
   00240 Pyrimidine metabolism
    Sputcn32_3556
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Sputcn32_3556
Enzymes [BR:spc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Sputcn32_3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABP77265
UniProt: A4YBD2
Position
4136129..4136830
Genome map
AA seq 233 aa AA seqDB search
MEYPMLNWNTIDTVLLDMDGTLLDLHFDNHFWLSLVPQVLSQQRGISTDDAQQLVVSAYG
KVAGTLDWYCLDYWQATLQLDIMGLHRTLVDRIQLRQDSMPFLDALASAGKKRILVTNAH
PKSLALKLEHTELGSGLDGMISSHETGYPKEHPQFWQTLFEKFVLDPSRCLFIDDSEPIL
NAARLAGVGHQLGIANPDSQKPLKIFHDFPAITDYHLLLDDLKQQKDNKNKGT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcccatgcttaactggaacactatagacacagtgctactcgacatggatggc
acattattagatttacactttgataatcatttctggctgagtttagtaccacaggtattg
agtcagcagcgaggtattagcacggatgacgcgcaacaattagtcgtgagtgcctatgga
aaagtggcaggaacactcgattggtattgcctcgattattggcaagcaacacttcagctc
gacattatgggcttgcatcgtactttggtggatcgcattcaactacgccaagatagtatg
ccctttttagatgccttagcctctgcgggtaaaaaacgtattcttgttaccaatgcgcac
cccaaaagtcttgctttaaagcttgagcatacagaacttggctcagggctagatgggatg
atttcaagccacgaaacaggttaccccaaggaacatccacaattttggcaaaccttgttt
gaaaaatttgtcctcgatccgagccgttgcctctttatcgatgacagtgagccgatactg
aatgcagcaaggttagcaggcgtgggtcatcaactggggatagccaaccccgatagccaa
aaaccgctaaaaatctttcacgacttcccagctattactgactatcacttattacttgat
gatttaaaacaacaaaaagataataaaaacaaaggcacctaa

DBGET integrated database retrieval system