KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0167Help
Entry
SPD_0167          CDS       T00413                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00740  Riboflavin metabolism
spd00790  Folate biosynthesis
spd01100  Metabolic pathways
spd01110  Biosynthesis of secondary metabolites
Module
spd_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:spd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SPD_0167 (ribB)
   00790 Folate biosynthesis
    SPD_0167 (ribB)
Enzymes [BR:spd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SPD_0167 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SPD_0167 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 PucR
Motif
Other DBs
NCBI-ProteinID: ABJ54400
UniProt: A0A0H2ZMP2
Structure
PDB: 

Position
complement(170814..172019)
Genome map
AA seq 401 aa AA seqDB search
MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENVNFMATYAKGLICMPM
SESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERGLTARMCVAEDITPSDF
RRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCEIMNHDGKMMRTDDLIQF
SKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKAISYIDKLNGEHHLALIMG
NIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIVENGSGVLLYLRQEGRGIGL
INKLKAYHLQDQGMDTLDANLALGFEGDLRKYHIGAQMLKDLGLQSLHLLTNNPDKVEQL
EKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNMEEK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgaaaaatacaagaagcattagaagcattgcagaagggacgacttgttctt
gttatagacgacaaggatagagaaaatgaaggagacttaatttgttctgcacaagcagct
acaacagaaaatgttaattttatggctacttatgccaaaggattaatttgtatgcctatg
agcgaaagtttagctaatcaattaatgctttcacctatggttgaaaacaatacagataat
cataagactgcttttacagtttcaattgattataaagaaacgaccacaggtatttctgcc
gaggaaagaggactgaccgcacgtatgtgtgtagctgaagatataacaccctctgatttt
cgcaggccaggacacatgtttcctttaattgcaaaaaaaggtggtgtcctagaaagaaat
ggacacacagaagcaactgttgatttattaaaattagctggactaaaagagtgtggccta
tgttgtgaaataatgaatcatgatggcaaaatgatgagaacagatgatttaattcagttc
tcgaagaaacacaacattccattaattaccatcaaagaattacaagaatatagaaaagta
tatgatcagctggtagaacgagtttcaactgtcaatatgcctactagatacggtaatttc
aaagcaattagctatatagataaactaaatggggaacatcatcttgctcttattatggga
aatatagaggatgaagccaatgtattatgtcgggtccactccgaatgtttaacaggagat
gttttaggctctttacgttgcgattgtggacagcaattcgataaagctatgaaaatgatt
gttgagaatggttcgggtgtcttactttacttgcgacaggagggacgaggaattggactt
atcaataaattaaaagcctatcatttacaagatcaaggcatggatacgcttgatgccaat
cttgcattaggctttgaaggtgatttaagaaaatatcatattggagcacaaatgcttaaa
gatctgggacttcagtcacttcatttactgacaaataatcctgacaaggttgaacagtta
gaaaaatatggaattaccatttccagtagaatatcaatcgaaatagaagccaatccttac
gatagtttttatttagaaacaaagaaaaatcgaatgggtcacattttaaatatggaggaa
aaataa

DBGET integrated database retrieval system