KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0347
Entry
SPD_0347          CDS       T00413                                 

Gene name
mvaD
Definition
(GenBank) diphosphomevalonate decarboxylase
  KO
K01597  diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00900  Terpenoid backbone biosynthesis
spd01100  Metabolic pathways
spd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPD_0347 (mvaD)
Enzymes [BR:spd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     SPD_0347 (mvaD)
SSDB
Motif
Pfam: MDD_C GHMP_kinases_N RRM_5
Other DBs
NCBI-ProteinID: ABJ54071
UniProt: A0A0H2ZN59
Position
351484..352437
AA seq 317 aa
MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEF
YINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNA
YFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPVETDLKLAMIMLVLEDKK
KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT
KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQR
YRLIVSKTKDLSQDDCC
NT seq 954 nt   +upstreamnt  +downstreamnt
atggatagagagcctgtgacagtacgttcctacgcaaatattgctattatcaaatattgg
ggaaagaaaaaagaaaaagagatggtgcctgctactagcagtatttctctaactttggaa
aatatgtatacagagacgaccttgtcgcctttaccagccaatgtaacagctgacgaattt
tacatcaatggtcagctacaaaatgaggtcgagcatgccaagatgagtaagattattgac
cgttatcgtccagctggtgagggctttgtccgtatcgatactcaaaacaatatgcctacg
gcagcgggcctgtcctcaagttctagtggtttgtccgccctggtcaaggcttgtaatgct
tatttcaagcttggattggatagaagtcagttagcgcaggaagccaagtttgcctcaggc
tcttcttctcggagtttttatggaccactaggagcctgggataaggatagtggagaaatt
taccctgtagagacagacttgaaactagctatgattatgttggtgctagaggacaagaaa
aaaccaatctctagccgtgacgggatgaaactttgtgtggaaacctcgacgactttcgac
gactgggttcgtcagtctgagaaggactatcaggatatgctgatttatctcaaggaaaat
gattttgccaagattggagaattaacggagaaaaatgccctggctatgcatgctacgaca
aagactgctagtccagccttttcttatctgacggatgcctcttatgaggctatggacttt
gttcgtcagcttcgtgagaaaggagaggcctgctactttaccatggatgctggtcccaat
gttaaggtcttctgtcaggagaaagacttggagcatttgtcagaaattttcggtcagcgt
tatcgcttgattgtgtcaaaaacaaaggatttgagtcaagatgattgctgttaa

DBGET integrated database retrieval system