KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0920Help
Entry
SPD_0920          CDS       T00413                                 

Definition
(GenBank) hypothetical protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABJ54230
UniProt: A0A0H2ZNI9
Position
933335..933496
Genome map
AA seq 53 aa AA seqDB search
MDNDWNGLADLIANLIAKYAGALDLDNLPDPTPAKNQEMKNSFDMAKTQIETD
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
ttggacaatgactggaatggattggctgatttaatagcaaatctgattgcaaaatatgct
ggtgctttagatttagataatctacccgatccaacgccagcaaaaaatcaagagatgaaa
aatagttttgacatggcaaaaacacaaattgagacggactaa

DBGET integrated database retrieval system