KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0923Help
Entry
SPD_0923          CDS       T00413                                 

Definition
(GenBank) hypothetical protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 DUF3226 Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: ABJ54162
UniProt: A0A0H2ZM42
Position
936414..936611
Genome map
AA seq 65 aa AA seqDB search
MMKMATDKNRIMISLDDKNLEKLENLVEDARDRRGMRLTKSQVIELLLNTVDYFDDIMGA
IYSKK
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatggcaaccgataaaaatagaataatgattagcttggatgataaaaatcta
gagaaacttgaaaatttagtagaagatgctagagatagaaggggaatgcgactaacaaag
tcccaggttattgaattactcctaaataccgttgattatttcgatgatattatgggggct
atttactcaaaaaaataa

DBGET integrated database retrieval system