KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0926Help
Entry
SPD_0926          CDS       T00413                                 

Definition
(GenBank) conserved hypothetical protein TIGR00147
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABJ55420
UniProt: A0A0H2ZRQ7
Position
938454..939338
Genome map
AA seq 294 aa AA seqDB search
MKKAMVIINPTSGGEKALDYKEKLENKAKEYFEYVETKITEKVLDATHFAEEASREQYDA
VVVFGGDGTVNEVISGIDERDYIPKLGIIPGGTGNLITKLLEINQDIDGAIDELDFDLTN
KIDIGKANDNYFGYIFSIGSLPEAIHNVEIEDKTKFGILTYAVNTMKSVMTDQVFNIKVE
TENGNYVGEASHVLVLLTNYFADKKIFEENKDGYANILILKDASIFSKLSVIPDLLKGDV
VANDNIEYIKARNIKISSDSELESDVDGDKSDNLPVEIKVLAQRVEVFSKPKED
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaatggtaattatcaaccctacttctggtggcgagaaggctttggattac
aaagaaaagctggagaataaagcaaaagaatactttgaatatgttgaaaccaaaattacc
gaaaaagtgctggatgcaacacattttgctgaagaagcttctcgtgagcagtatgatgca
gtggttgtgtttggtggagatggaactgtcaatgaagtcatttcaggtattgatgagaga
gactacattcctaagttagggattatcccaggcggtacgggtaacctcattacaaaactt
ttggaaatcaatcaagacatcgatggcgcaattgacgaactagattttgatttaaccaat
aagattgatatcggtaaagcaaatgacaactattttggttatatctttagtatcggttct
ctgcctgaggcgattcacaatgttgaaatagaggacaaaacaaaattcggtattttaacc
tatgctgtaaataccatgaagtctgtcatgacagatcaggtctttaacattaaggttgag
acagaaaatggaaattatgttggtgaagctagccatgttttggtccttttgacaaattac
ttcgctgataagaaaatctttgaagaaaacaaggacggctatgccaacattttgattctg
aaagatgcctctatattctccaaattatccgtcattcctgatttattaaaaggggatgtt
gtcgcaaatgataatatcgagtatatcaaagcgcgtaatattaaaatctcttcagatagt
gaattggagtcagatgttgacggagataaatcagataacctacctgtagaaatcaaagtc
ctagctcagcgagtagaagtattttcaaaaccgaaagaggattag

DBGET integrated database retrieval system