KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0932Help
Entry
SPD_0932          CDS       T00413                                 

Definition
(GenBank) hypothetical protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABJ54937
UniProt: A0A0H2ZP98
Position
943680..944456
Genome map
AA seq 258 aa AA seqDB search
MRGFNNKIKSVYQELTNSKEKFGSFHKTLIHLHTPVSYDYKLFSNWTATKYRKITEDELY
DIFFENKKIKVDKTIFFSNFDKVVFSSSKEYISFLMLAEAIIKNGIEIVVVTDHNTTKGI
KKLQMAVSIIMKNYPIYDIHPHILHGVEISAADKLHIVCIYDYEQESWVNQWLSENIISE
KDGSYQHSLTIMKDFNNQKIVNYIAHFNSYDILKKGSHLSGAYKRKIFSKENTRFWSLIL
TRKNLRNNLIFSIKKLVY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagagggtttaataacaagataaagtctgtttatcaagaactaacaaattccaaagag
aaattcggtagctttcacaagactttaattcatttgcatacacctgtttcttatgattac
aagctattttctaattggactgcaacgaaatatagaaaaattactgaagatgaactatat
gatatattttttgaaaataagaaaataaaagttgataagacaattttttttagtaatttt
gataaggttgttttttctagttcaaaagaatatattagttttcttatgttagcagaggca
atcataaaaaatggaatagaaatagttgtagtaactgatcataatactaccaaaggtatt
aaaaagttacaaatggcagtctcaatcataatgaaaaattatccgatttatgatatacat
cctcatattttacatggagtagaaattagtgcagcagataaattgcatattgtatgtata
tatgattatgaacaagaatcatgggttaatcaatggttaagtgaaaatattataagtgag
aaagatggaagttatcaacattcactgactataatgaaggatttcaataatcaaaaaata
gttaactatattgctcatttcaatagttatgacattttgaaaaaaggttctcacttatca
ggtgcatataaacgaaaaattttttctaaagaaaatacacgattttggagtttaatatta
actcgaaagaatcttcgcaacaacttgatattctctataaagaagttggtgtattaa

DBGET integrated database retrieval system