KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0939Help
Entry
SPD_0939          CDS       T00413                                 

Definition
(GenBank) transcriptional activator, Rgg/GadR/MutR family protein
  KO
K20374  HTH-type transcriptional regulator, SHP3-responsive repressor
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spd00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPD_0939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spd03000]
    SPD_0939
Transcription factors [BR:spd03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SPD_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19
Motif
Other DBs
NCBI-ProteinID: ABJ54684
UniProt: A0A0H2ZNB8
Position
complement(948319..949173)
Genome map
AA seq 284 aa AA seqDB search
MKSKLGVTLRKIRKGKQISLCSVADEHLSKSQISRFERGESEISCIRLINILDKLHITLD
EFLILHDEDYTKTESFANLVQYIRKQYSSQSINNIACLLSDTSDYTLNSFEKTMVKSILH
TMDSNIIPSDEELLHLTDYLFKIEKWGYYEIILLGNCVRTINYNSYFLLTKEMLNNYIYS
SLNKTNKQIVSQLAINCFILSIDKEEFSNCSYLISKIKTLLDNELNFYEQTVFLYATGYF
EFKRCQSTSGIEKMKQAIQVFDILGENKLKLHYTDHFNKPVNKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaacttggtgtcacacttagaaaaattcgtaagggcaaacaaattagtcta
tgttctgtagctgatgagcatctttcaaaatcgcaaatctctcgttttgaacgtggggaa
tcagaaatatcttgtattcgactgatcaatattttagacaaattacacattacgttagat
gagtttcttattttacacgatgaagactataccaaaactgagtcttttgctaacttagta
cagtatatccgtaaacaatattcatcacaaagtatcaataatatagcatgtctactttct
gatacttctgattacactctaaattcttttgagaaaacaatggtaaaatctattttacac
acaatggattcgaacatcattccatcagatgaagagcttcttcatctgacagactatctt
ttcaaaattgaaaaatggggctattatgaaatcattttattaggtaactgtgtacgcaca
attaactacaactcctacttcttattaactaaagagatgttaaataactatatttactca
tctctgaataaaactaataagcagattgtctctcagcttgctattaattgcttcattcta
agcattgataaggaagaattttctaattgctcctatttaattagtaagataaagacattg
ttggataatgaactaaacttttatgaacaaacagtttttctctatgcaactggttacttt
gaatttaaacgttgccaatcaaccagtggaattgaaaaaatgaaacaagccatacaagtc
ttcgatattttaggagaaaataagttaaaattacactatactgaccattttaataaacca
gtaaacaaaaaataa

DBGET integrated database retrieval system