KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0940Help
Entry
SPD_0940          CDS       T00413                                 

Definition
(GenBank) UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase, putative
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_C UDPG_MGDP_dh_N UDPG_MGDP_dh 3HCDH_N Pyr_redox_2 AlaDh_PNT_C NAD_binding_8 DAO Pyr_redox 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABJ53975
UniProt: A0A0H2ZM34
Position
949425..950720
Genome map
AA seq 431 aa AA seqDB search
MKNNFLSRIQNKKANITIWGAGYIGLSTAYHFALVGFRVKIFDTNHRLIQNLLEGNLPFK
IDLDEEIFSKLIFNKSILPEVVEHADTYSDEIQIICINTERNGVPISRPLTTVLDNITTV
SEQLVIVESTISPNWIDTIIRPKLNDLQYLTVAPRRDWFLETGLNLKTLPRVIGTLGSNY
RMEVLKLYEMLSDVVIEVTDAYHACLVKAVENSIRYINVVFANEMMRAFPRYNMAEIFDA
ASTKWNIPYYHPSIGIGGYCLPLAPKYILDAVNDSEELPMLRESVKSDLKQSDFITDLIK
SYNCQKVGVLGLSYAPETKIWKNSPVVSLIYSLLRNGIEVKINDPYFSSEEIQEITTVQS
FSLNSESLQEFDILVIATSHKSYDGELERILFDLNKEMIIFDNFGVNKNLSKLPNIHYFE
IGNFQYNESRR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatttcctaagtagaattcaaaataagaaggcaaatattacaatttggggt
gcaggatatataggtctatctacagcttaccactttgcattggtaggtttccgcgtcaaa
atttttgatactaatcatagattgatacagaatttacttgaaggaaatctgccatttaaa
attgatttagatgaagaaatatttagtaagttaatatttaataaatccattttaccagaa
gttgtagaacatgctgatacatattctgatgagatacaaattatctgtattaatactgaa
agaaatggagtacctattagtagaccattaactactgtattagataatataacaacagta
tctgaacaactagttattgttgaaagtacaatttctccaaattggattgatacaattata
agaccaaagttgaatgatttgcaatatctaacagttgctcctaggagagactggttttta
gagactggattaaatttaaaaacacttcctcgagttattggtacattgggatcaaattat
cgtatggaggttttgaaattatatgaaatgctttctgatgttgtgattgaggtaactgat
gcatatcacgcttgtttagtaaaggcggttgaaaattctatacgctatattaatgttgta
tttgctaatgaaatgatgagagcatttccaagatataatatggctgaaatttttgatgct
gcttcaactaagtggaatattccttattatcatccgtcaattggaattggagggtactgt
cttccgttagctcctaaatatattttggatgcagtcaatgatagtgaggagttacctatg
ctgagggagtcagttaaatctgatttaaagcagtctgactttattactgacttaatcaaa
agctataactgtcaaaaagtaggagtattaggtctaagttatgctccggagactaaaatt
tggaagaattccccagttgttagtttaatctattctttgttaagaaatggaatagaagtg
aaaataaatgatccatatttctctagtgaagaaattcaagaaataacgactgttcaatct
ttcagtttaaatagtgagtcactacaagaatttgatatactggtaattgctacctcacat
aaaagctatgatggagaattggagagaatactttttgatttaaataaagaaatgattatt
tttgataattttggagtgaataagaatctatctaaattaccaaatattcattattttgaa
attgggaacttccaatataatgaaagtaggagataa

DBGET integrated database retrieval system