KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0943Help
Entry
SPD_0943          CDS       T00413                                 

Definition
(GenBank) hypothetical protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ABJ55334
UniProt: A0A0H2ZQ28
Position
952145..954037
Genome map
AA seq 630 aa AA seqDB search
MKKCWLTTNFEDYLKALSTNELTLLVKNLEIDLSEISIFYDVKFEFYKKDRLSITDKGKT
VDSESIIIYIGSNTKCQKIVELYASNRKYNFISYKSINNFLDTEFEQKYAYVTIVCNFDI
IDDSIFYKCTNKFNVNNIYTSVGFFLYDDIYDLTYQVFKTVSLENTFRDNSLLITHDEKI
KNKNYYNFFDSEKGKFPYTDEMDIFSFHGHSREDKLFIYNGYVCCTNNDNNVMETRNIND
IPHWAKNPEYYEGKKDIVDIKEIKCKIAFLNSCSGIHLKKSLYRKEYWISEGFRVSYPAV
VIGSTIIKDGSSIENIFFIELIKAGYSVGESVNVLNKMSKALKYDTGSFCILGAPEFRLT
TPNSRFENTLHEIQQFTENLIVLKNRLKKYLEIFHKQKRIDIYGIKDKRIQNIQMNVGNQ
LQSLVRKINISNIHRYNLGQLNHEMDSLESQLTDLQNRIISDLSTKTRTGNYLFSEYYHE
LSEIDYEEFRENSCPNCNNSILLQKFTVVPENINRFVYKCSRCGTSIDLPSNVFVDINLK
IEINIEELEIKVFFDYQNLIKKGEFTTIDCEILEADRYSIERVVANNQDNVQGEITFKYN
RQKTPMQVYYLKAYVMIDGQLLHRSIPINL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgttggcttacaacaaactttgaagactatctaaaagcattaagtacaaac
gaattgacattacttgtgaaaaatttagaaattgatttgtcagaaatttcaattttttac
gatgtgaagtttgaattttataaaaaggacagattatcaataacagacaaaggaaagact
gtagatagcgagtcaatcattatttatattggaagtaacaccaagtgtcagaagattgta
gagttatatgcaagcaatagaaagtataattttatttcatataaaagtataaataatttt
ttggatactgagtttgaacagaaatatgcttatgtgacaattgtctgtaactttgatatt
attgatgacagtattttttataaatgtactaacaaatttaacgtaaataatatttatact
tctgtaggtttttttttgtatgatgacatatatgatttaacttatcaggtatttaaaaca
gtttccttagaaaatacctttagagataattctttattgatcacacacgatgaaaagata
aaaaataaaaactattataatttctttgattctgagaagggaaaattcccatatactgat
gagatggatattttttcattccatggacacagtcgagaagataaactctttatttataat
ggatatgtatgttgtacaaataatgataataatgtgatggaaacgagaaatatcaatgat
attcctcattgggctaaaaatccagaatactatgagggaaaaaaggacatagtagatatt
aaagaaataaaatgtaaaattgcctttttaaattcttgtagtggtattcacttaaaaaaa
agtctatatcgaaaggaatattggatttctgaaggctttcgtgttagctatccagctgta
gtaattgggagtactattattaaagatggtagtagtattgaaaatatattctttatagaa
ttaataaaagctggatatagtgtgggggaatcagttaatgttttgaacaaaatgtcaaaa
gccttaaagtatgatactggttcgttttgtattttaggtgctcctgaatttaggctgaca
actccaaatagtaggtttgagaatacattgcatgaaatccaacaattcactgaaaatctt
attgttctgaaaaatcgtttaaaaaaatatttggaaatttttcataaacaaaagagaata
gatatttatggtataaaagataaacgaattcaaaatatacaaatgaatgtaggcaatcag
ctacaatcgcttgtgagaaaaatcaatatttcaaatatacatagatataacttaggtcaa
ttaaatcatgaaatggatagtctagaaagtcaattaacggatttacagaatagaataatt
tccgatttgagtacgaaaactagaacaggaaattatttattttcagagtattatcatgaa
ctttcagaaatagattatgaagagtttcgagaaaactcttgtcccaattgtaataattcc
attctgctacagaaattcacagtagtcccagaaaatataaataggtttgtgtataaatgt
tcaagatgtggtacatcaattgatttacctagtaatgtttttgtagatataaatttaaaa
attgaaattaatattgaagaattagagataaaggtattctttgattatcaaaacctcatt
aagaaaggggaatttacaacaatagattgtgaaatattagaggccgatagatattcaatt
gaaagagtagtagctaataatcaagataatgtgcagggggagattacttttaaatataat
cgccaaaagacaccgatgcaagtatattatttgaaagcatatgtaatgatcgatggtcag
ttactacataggagtattcctataaatttgtaa

DBGET integrated database retrieval system