KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0946Help
Entry
SPD_0946          CDS       T00413                                 

Definition
(GenBank) hypothetical protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His DUF3696 tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ABJ54005
UniProt: A0A0H2ZN84
Position
956492..957715
Genome map
AA seq 407 aa AA seqDB search
MVRNGNIKLDYPKGFFDLDEMQFKKYCDIENHLRSIASINGFELIKVSSAVYSRLNEYTH
ASIGRYYQVKDEKNRNIGLSSDGSMSILRYFYNNKQGYSSYKVCSNATIYRKNKKLREFS
QFCYEIFNASSIDELQFNYINLILEILDSLELESVVILTNFNIWKIILSRYNNYKDVLYE
LRKSKDILGMINSLNIDPSYVKFLSKFHKRNFTIYDLLNYCRVHKLFELIDELCQMQKYI
EYIQHRITFQINLFDFRGSEIFEGIYYKCVDKYERPFLDAGTYSNLIFEVTKKNILSGGL
AVCIEAILDRIHISQKPKKVFVKYVGGENFKIDDFYNILTLIRKEKLKNHFVKEEVSSLA
IAKAKRRAYIQKYDLFIAIGEREKNSHEFMIEELKTGLRRILILNGG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggttagaaatggaaatattaagttagattatccgaaaggcttttttgatcttgatgaa
atgcaatttaagaagtattgtgacatagaaaatcatttaaggagcatagcctctataaat
ggttttgaattgatcaaagtgtcatctgctgtttatagtcgtttaaatgaatacacccat
gcatccataggaagatattatcaagttaaagatgaaaaaaatagaaatatcggactaagc
tcggatggttctatgtctatactaagatatttttataataataagcaggggtacagtagt
tataaggtttgttccaatgcaacaatttatcgaaaaaataaaaaactacgggagttttca
caattttgctacgaaatttttaatgcttcctcaatcgatgagttacagtttaattatatc
aatttaattcttgagattcttgattcacttgagctagaaagtgtagttatattaactaat
ttcaatatttggaaaataattttatcacgatacaataattataaggatgtactatatgag
ttgagaaagagtaaagacatattaggtatgataaattcattaaatattgatccaagttat
gtaaaatttttatcgaaatttcataagaggaattttacaatatatgatttattaaactat
tgtagggttcataaactattcgaactaattgatgaactttgtcaaatgcagaaatatata
gagtatatacaacatcgcattacttttcaaattaatttgttcgactttagaggatctgaa
atttttgaaggtatttattataaatgtgtagataaatatgagagaccatttttagatgct
ggaacttactctaatttaatatttgaagtaactaaaaagaacattctcagtggtggtttg
gcggtctgtatagaagctattttagatagaattcatatttcacaaaaacctaaaaaagtt
tttgtgaaatatgttggtggagagaatttcaaaatcgatgatttttataatattttgact
ctcatccgaaaggaaaaattaaaaaatcattttgttaaagaagaagttagttcgttggct
atagctaaagctaagaggagggcctacattcagaaatacgatttatttatagctattggt
gaaagggaaaaaaacagtcatgaatttatgattgaagaattaaaaacaggattaagaaga
atattaatattaaatggaggataa

DBGET integrated database retrieval system