KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0950Help
Entry
SPD_0950          CDS       T00413                                 

Definition
(GenBank) transporter, major facilitator family protein
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 FPN1
Motif
Other DBs
NCBI-ProteinID: ABJ53827
UniProt: A0A0H2ZLT5
Position
960915..962126
Genome map
AA seq 403 aa AA seqDB search
MKIDKKNEAFLIVSRGISRIGDIMFDFANNTFLAGLNPTSLSLVAVYQSLESVIGVLFNL
FGGVIADSFKRKKIIIVANILCGIACIILSFISQEQWMVFAIVITNIILAFMSAFSGPSY
KAFTKEIVKKDSISQLNSLLEITSTIIKVTIPMVAILLYKLLGIHGVLLLDGFSFLIAAS
LISFIVPVNDEVVTKDKMTIGGVLNDLKIGFKYIYSHKTIFMIIILSAFVNFFLAAYNLL
LPYSNQMFGEISDGLYGVFLTAEAIGGFIGAILSGVINKTLSSKRLMVFLSCSGLMLMLS
TPLYFLFQNFIILAFSPALFSLFISIFNIQFFSIVQREVDTEFLGRVFGIIFTVAILFMP
VGSGFFSVVLNPNNTFNLFIIGVSITILSLIFSTLLKRYDKNS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatagataaaaaaaacgaggctttccttattgtaagtagaggcatatctcgaatt
ggagatattatgtttgactttgcgaataatacctttcttgcaggattaaatccaacatct
ttatcattggttgcagtatatcagtcactagaaagtgtgataggtgttctttttaattta
tttggtggagtcattgcagatagtttcaagcggaaaaaaattattattgttgcaaatatc
ttatgtggtattgcttgtataattctttcattcatatcacaagagcagtggatggtcttt
gcaattgtcatcactaatattatcttggcatttatgagtgctttttctggaccgtcctat
aaagcatttacaaaagaaattgtaaaaaaggatagtatatcacaacttaattcattgcta
gagataacaagtactataattaaagtaacaataccaatggtagcaattttattatataag
ctacttgggatacatggtgttttactattggatggattctcatttctaattgctgcatca
ctgatttcctttattgtacccgttaatgacgaagtggtcacaaaggataaaatgacaata
ggaggagttttaaatgacttaaaaatagggtttaagtatatttatagtcataagacaata
tttatgattattattctctctgcttttgttaatttttttctagcagcttataatttattg
ttaccttatagtaatcaaatgtttggagaaatttcagatgggctttatggtgtttttcta
actgcggaagcaattggaggatttattggagcgatattaagtggtgttataaataaaacc
ttgtcaagcaaacgtttaatggtcttcttatcatgttcaggattgatgttaatgctatca
acgccactctattttttgtttcaaaacttcattattctagccttttctccggcattattt
agtctatttatttctatttttaatattcaatttttctctattgttcaaagagaagttgat
actgagtttctcggtagagtctttggaatcatctttacggtagctattctttttatgcca
gttgggtctggatttttctcagtagttttaaatcctaacaatacttttaatctttttatt
attggtgtatctattacgatattatcgctaatattcagcacgctattgaagaggtatgat
aaaaatagctga

DBGET integrated database retrieval system