KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1187Help
Entry
SPD_1187          CDS       T00413                                 

Gene name
rplL
Definition
(GenBank) ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPD_1187 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spd03011]
    SPD_1187 (rplL)
Ribosome [BR:spd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPD_1187 (rplL)
  Bacteria
    SPD_1187 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: ABJ54917
UniProt: Q04JZ4
Position
complement(1214853..1215221)
Genome map
AA seq 122 aa AA seqDB search
MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVAAADAADAGAAKDSFDVEL
TSAGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKAKLEEAGASVT
LK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcattgaacattgaaaacattattgctgaaattaaagaagcttcaatccttgaattg
aacgaccttgtaaaagctatcgaagaagaatttggtgtaactgcagctgctcctgtagct
gttgctgcagctgatgcagctgatgctggtgctgctaaagattcattcgacgttgaattg
acatctgcaggcgacaaaaaagttggcgttatcaaagttgtacgtgaaatcactggtctt
ggtcttaaagaagctaaagaacttgttgacggtgcaccagcacttgttaaagaaggcgtt
gcaactgcagaagctgaagaaatcaaagctaaattggaagaagctggagcttcagttact
cttaaataa

DBGET integrated database retrieval system