KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1536Help
Entry
SPD_1536          CDS       T00413                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00900  Terpenoid backbone biosynthesis
spd01110  Biosynthesis of secondary metabolites
spd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPD_1536
Enzymes [BR:spd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPD_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ABJ55014
UniProt: A0A0H2ZP57
Structure
PDB: 

Position
complement(1558731..1560005)
Genome map
AA seq 424 aa AA seqDB search
MKISWNGFSKKSYQERLELLKAQALLSPERQASLEKDEQMSVTVADQLSENVVGTFSLPY
SLVPEVLVNGQEYTVPYVTEEPSVVAAASYASKIIKRAGGFTAQVHQRQMIGQVALYQVA
NPKLAQEKIASKKAELLELANQAYPSIVKRGGGARDLHVEQIKGEPDFLVVYIHVDTQEA
MGANMLNTMLEALKPVLEELSQGQSLMGILSNYATDSLVTASCRIAFRYLSRQKDQGREI
AEKIALASQFAQADPYRAATHNKGIFNGIDAILIATGNDWRAIEAGAHAFASRDGRYQGL
SCWTLDLEREELVGEMTLPMPVATKGGSIGLNPRVALSHDLLGNPSARELAQIIVSIGLA
QNFAALKALVSTGIQQGHMKLQAKSLALLAGASESEVAPLVERLISDKTFNLETAQRYLE
NLRS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagttggaatggattttctaaaaaatcataccaagagcgcctcgagctgcta
aaagctcaggcgctccttagtcctgagagacaagctagtctggagaaggatgaacagatg
agtgtgactgtggcagaccagctgagtgagaatgtggtgggaactttttctctgccttat
tcgctggttccggaggtacttgtcaacggtcaggaatacaccgttccctatgtgacagaa
gaaccctctgtggttgcggcggccagctatgccagcaaaatcatcaagcgtgcaggtggt
tttactgcacaagtccatcagcgccagatgattgggcaggtagccctttatcaagttgct
aatcctaaactagcgcaagagaagattgccagcaagaaagcggagctcttggagcttgcc
aatcaagcctatccttctatcgttaaacgtgggggtggggcgcgtgatctgcatgtcgag
cagataaaaggcgaaccagactttctcgttgtttatattcatgtcgatacccaggaagcc
atgggtgccaatatgctcaacaccatgctggaagccttgaaaccagtcttagaagaactc
agtcagggacagagtctcatgggaatcctgtccaactacgcgactgattctctggtgact
gcaagctgtcgcatcgcctttcgctacttgagccgccaaaaggatcaaggacgagagatt
gcggagaaaattgcgttggctagtcagtttgcgcaggctgatccttaccgagctgctact
cataataaaggaatttttaatggtattgatgcgattttgattgccactggtaatgactgg
cgtgccatcgaagctggggcccatgcctttgccagtcgagatggacgctatcaaggtctt
agctgctggacgctggaccttgaaagagaagaattggtcggtgagatgaccctgcccatg
cctgtagcgactaagggtggctctatcggcctcaacccacgtgtagctctcagtcatgat
ctactaggaaatccttctgccagagaattagcccagattatcgtgtccatcggtcttgct
caaaattttgcagccctcaaagccttggtaagtacgggcatccagcaaggccacatgaaa
ctacaggccaaatccctagctctcctagctggggctagtgaatctgaagttgctccccta
gtagagcgcctcatctcagataaaacctttaacctagagacagcccagcgctatctcgaa
aatttaagatcataa

DBGET integrated database retrieval system