KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1986
Entry
SPD_1986          CDS       T00413                                 

Gene name
fucI
Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00051  Fructose and mannose metabolism
spd01100  Metabolic pathways
spd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPD_1986 (fucI)
Enzymes [BR:spd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     SPD_1986 (fucI)
    5.3.1.25  L-fucose isomerase
     SPD_1986 (fucI)
SSDB
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Other DBs
NCBI-ProteinID: ABJ54752
UniProt: Q04I16
Structure
PDB: 
4C20 4C21 4C22

Position
complement(1959133..1960899)
AA seq 588 aa
MIQHPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTI
GRVPEAAASHELFKKSNVCATITVTPCWCYGSETMDMSPDIPHAIWGFNGTERPGAVYLA
AVLASHAQKGIPAFGIYGRDVQEASDTAIPEDVKEKLLRYARAALATGLMRDTAYLSMGS
VSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERALKWVKENVKEGF
DHNREDLVLSREEKDRQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQ
RQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNTPQIFADV
RTYWSPEAVERVTGYTLEGRAAAGFLHLINSGSCTLDGTGQATRDGKPVMKPFWELDESE
VQAMLENTDFPPANREYFRGGGFSTRFLTKGDMPVTMVRLNLLKGVGPVLQIAEGYTLEL
PEDVHHTLDNRTDPGWPTTWFAPRLTGKGAFKSVYDVMNNWGANHGAITYGHIGADLITL
ASMLRIPVNMHNVPEEDIFRPKNWSLFGTEDLESADYRACQLLGPLHK
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgattcaacatccacgtattgggattcgtccgactattgatggtcgtcgtcaaggtgta
cgcgaatcacttgaagtacaaacaatgaacatggctaaaagtgtggcagatttgatttca
agcacattgaaatatccagatggggaacctgtggaatgtgtgatttctccatctaccatt
ggtcgtgttccagaggctgcagcttcccatgagttgttcaaaaaatcaaatgtttgcgca
acaattacagttacaccatgctggtgttatggtagtgaaactatggatatgtctccagat
attcctcatgctatttggggatttaatgggacagaacgcccaggagctgtctatcttgca
gctgtactagcttcacatgctcaaaaagggattccagcctttgggatttatggtagagac
gtccaggaagctagtgatacagctattccagaagatgtcaaagaaaaacttttacgttat
gcgcgtgcagctcttgcaactggcttgatgagagacactgcttacctatcaatgggtagt
gtttcgatggggattggcggttctattgtaaatccagatttcttccaagaatacttagga
atgcgaaatgaatcggtagatatgacggagttcacgcgccgtatggaccgtggtatttac
gaccctgaagagttcgaacgtgcgctcaaatgggtgaaagaaaacgtaaaagaaggattc
gaccataaccgtgaagaccttgttttaagccgtgaagaaaaagatagacaatgggaattt
gttattaagatgttcatgattggacgtgacttaatggttggtaacccaagacttgctgaa
cttggttttgaggaagaagcagttggtcaccatgctttagtagctggtttccaaggtcaa
cgtcagtggacagaccattttccaaatggggactttatggaaactttcctcaatactcag
tttgactggaatggtattcgaaaaccatttgtatttgcgacagagaatgattcactaaat
ggtgtgtctatgctctttaattatctattaacaaatactccacaaatctttgctgatgtg
cgtacttattggagtccagaggctgttgaacgtgtaacaggatatactttagagggtcgt
gctgcagctggattcttacatctaatcaactctggatcttgtacattggatggtacaggt
caagctactcgagatggcaaacctgttatgaaaccattctgggagttggatgaaagtgaa
gtacaggctatgcttgaaaatacagacttcccaccagcaaaccgcgaatacttccgtgga
ggaggattctcaactcgtttcttgacgaagggggatatgccagtaacaatggtacgtctc
aatcttttaaaaggggttggtccagtgctacaaattgcagaaggttacacacttgaactt
cctgaagatgttcaccatactttagataatcgtacagatccaggatggccaactacttgg
tttgctccacgtttgacaggaaaaggtgctttcaagtctgtctatgacgtcatgaataat
tggggagctaatcacggagccataacatatggacacattggagcagacttgattaccttg
gcttctatgttgagaattcctgtcaatatgcataatgtacccgaggaagatatctttaga
cctaaaaattggtccttatttggaacagaagatctagaatcagcagactatcgtgcatgt
cagttgttgggaccactacataaataa

DBGET integrated database retrieval system