KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1994Help
Entry
SPD_1994          CDS       T00413                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00051  Fructose and mannose metabolism
spd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPD_1994 (fucA)
Enzymes [BR:spd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SPD_1994 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABJ55065
UniProt: A0A0H2ZQ74
Structure
PDB: 

Position
complement(1969367..1970005)
Genome map
AA seq 212 aa AA seqDB search
MSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDIVVMDI
NGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYMIAVAG
KDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGAQNLLNAFNIVEEVEYCAKI
YCLAKNFGEPVVLPDEEMELMAEKFKTYGQRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaaaacaagaattaattaaatatggtaagaagctagtagaaacagatttg
acgaaaggaacaggtgggaatctcagcgttttcgatcgtgaaaaacaattgatggcaatt
accccgtcgggtattgatttctttgaaatcaaagaatccgatattgtagtgatggatatt
aatggaaatgttgtagagggagaacgcttgccatctagcgaatggtatatgcatttgatt
caatatcaaactcgtgatgatatcgatgcaattatccatgctcatacaacttatgcaaca
gtattagcttgtctcagagaaccacttccagcgagtcattatatgattgcagtggcaggg
aaagatgttcgggtagctgagtatgcaacatatggtacgaaagaattggctgtgaatgca
gctaaagcaatggaaggtcgtagagcagttttactagcgaatcatggaattttagcaggt
gcacaaaatttattgaatgcatttaatattgttgaagaagttgaatattgtgcaaaaatt
tattgtttagctaagaattttggagagccagtagttcttcctgatgaggagatggaattg
atggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system