KEGG   Serratia proteamaculans: Spro_0137
Entry
Spro_0137         CDS       T00595                                 
Name
(GenBank) Chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
spe  Serratia proteamaculans
Pathway
spe00520  Amino sugar and nucleotide sugar metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_0137
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Spro_0137
SSDB
Motif
Pfam: Glyco_hydro_18 ChitinaseA_N PKD DUF1539
Other DBs
NCBI-ProteinID: ABV39247
UniProt: A8G807
Position
146170..147861
AA seq 563 aa
MRKFNKPLLALLIGSTLCSAAQAAVPGKPTLAWGNTKFAIVEVDQAATAYNNLVKVKNAA
DVSVSWNLWNGDTGTTAKVLLNGKEVWSGASTGASGTANFKVNKGGRYQMQVALCNADGC
TASDATEIVVADTDGSHLAPLKEPLLEKNKPYKQDSGKVVGSYFVEWGVYGRNFTVDKLP
AQNLTHLLYGFIPICGGDGINDSLKEIEGSFQALQRSCQGREDFKVSIHDPFAALQKGQK
GVTAWDDPYKGNFGQLMALKQARPDLKILPSIGGWTLSDPFFFMGDKAKRDRFVGSVKEF
LQTWKFFDGVDIDWEFPGGQGANPKLGSAQDGATYVQLMKELRAMLDQLSAETGRKYELT
SAISAGKDKIDKVDYNTAQNSMDHIFLMSYDFYGAFDLKNLGHQTALKAPSWKPDTAYTT
VNGVNALLTQGVKPGKIVVGTAMYGRGWTGVNGYQNNIPFTGTATGPVKGTWENGIVDYR
QIANEFMSGEWQYSYDATAEAPYVFKPSTGDLITFDDARSVQAKGKYVLDKQLGGLFSWE
IDADNGDILNNMNSSLGNSAGTQ
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgcgcaaatttaataaaccgctgttggcgttgctgatcggcagcacgctgtgctctgcg
gcgcaggccgccgtaccgggtaagcctacgctggcctggggcaataccaagttcgccatt
gtcgaagtcgatcaagcggcgacggcttataataacctggtgaaggtgaaaaatgccgcc
gacgtttccgtttcatggaatttatggaatggcgataccggcaccacggcaaaagtatta
ttaaatggcaaagaagtctggagcggtgcctcaaccggcgcttcgggtacggcaaacttt
aaggttaataaaggcggccgttatcaaatgcaggtggcattatgtaatgccgacggttgt
accgccagcgacgctaccgaaattgtggtggcagataccgatggcagtcatttggcacca
ttaaaagaaccgttgctggaaaagaataaaccttataagcaggattccggcaaagtggtc
ggttcttatttcgttgaatggggcgtttacggccgtaatttcaccgtcgataaactgccg
gcacagaacctgacgcatttgctgtacggtttcattccaatctgcggcggtgacggcatc
aacgacagtctgaaagagatcgaaggcagtttccaggcgctgcaacgctcttgccagggg
cgtgaagacttcaaggtgtcgatccacgatccgttcgccgcactgcagaaagggcaaaaa
ggcgtgaccgcctgggacgacccctacaaaggtaactttggtcagttgatggcgctgaag
caggctcgtccggacctgaaaatcctgccgtcgattggtggctggaccctgtccgacccg
ttcttctttatgggtgacaaggccaagcgcgatcgcttcgtcggctcggtgaaagagttc
ctgcaaacctggaagttctttgacggcgtggatatcgactgggagttcccgggcgggcag
ggcgctaacccgaaactgggcagcgcacaggatggggcgacctatgtgcaactgatgaaa
gaactgcgggcgatgctggatcagctttccgcggaaaccggtcgcaagtatgaactgacc
tctgcgatcagtgccggcaaggacaaaatcgacaaggtggactacaacaccgcgcagaac
tcgatggatcacatcttcctgatgagttacgacttctatggcgcgttcgatctgaaaaac
ctgggccatcagaccgcactgaaagcgccgtcctggaaaccggatacggcctataccacg
gtgaatggcgttaacgcgctgctgacgcagggggtgaagccgggcaaaatcgtggtgggg
actgccatgtacggccgcggctggaccggtgttaacggctaccagaacaacattccgttt
accggcaccgcgaccggcccggtaaaaggcacctgggaaaatggcatcgtggattaccgc
caaatcgccaatgagtttatgagcggtgaatggcagtacagctacgacgccactgccgaa
gcgccttatgtgttcaaaccttccaccggtgacctgatcaccttcgacgatgcccgctcg
gtacaggcgaagggcaagtatgtgctcgataagcagttgggcgggttgttctcctgggaa
atcgacgccgataacggagatattctgaacaatatgaatagcagcctgggcaacagcgcc
ggcacgcaataa

DBGET integrated database retrieval system