KEGG   Serratia proteamaculans: Spro_0261Help
Entry
Spro_0261         CDS       T00595                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
spe  Serratia proteamaculans
Pathway
spe00071  Fatty acid degradation
spe00280  Valine, leucine and isoleucine degradation
spe00281  Geraniol degradation
spe00310  Lysine degradation
spe00362  Benzoate degradation
spe00380  Tryptophan metabolism
spe00410  beta-Alanine metabolism
spe00640  Propanoate metabolism
spe00650  Butanoate metabolism
spe00903  Limonene and pinene degradation
spe00930  Caprolactam degradation
spe01040  Biosynthesis of unsaturated fatty acids
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
spe01212  Fatty acid metabolism
Module
spe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spro_0261
   00650 Butanoate metabolism
    Spro_0261
  Lipid metabolism
   00071 Fatty acid degradation
    Spro_0261
   01040 Biosynthesis of unsaturated fatty acids
    Spro_0261
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spro_0261
   00310 Lysine degradation
    Spro_0261
   00380 Tryptophan metabolism
    Spro_0261
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spro_0261
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Spro_0261
   00281 Geraniol degradation
    Spro_0261
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spro_0261
   00930 Caprolactam degradation
    Spro_0261
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Spro_0261
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Spro_0261
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Spro_0261
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Spro_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABV39371
UniProt: A8G8D1
Position
complement(290398..292587)
Genome map
AA seq 729 aa AA seqDB search
MLYQGETLQLHWLDNGIAELVFNAPGSVNKLDTRTVASLGEALAVLEKQTELKGLLLRST
KAAFIVGADITEFLSLFAAPAEKLQEWLNFANAIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRVASPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSALEIIAAGKDVSAKDALK
VGLVDAVVAPEKLVEAALKMLQQAIEGKLDWRAYRQPKLEPLKLSPIEAAMSFTTAKGMV
MQTAGKHYPAPMTAVKTIEAAARLGRDEALKLETASFVPLARSKEARALVGIFLNDQFVK
GQAKKLAKGIEAPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDISDKSLTLGMNEAAKLL
NKQLERGKLDGMKMAQVLSTIQPTLDYAGIERAQVIVEAVVENPKIKAAVLSEVEGLIGE
NTVLASNTSTIPINHLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDSTIAAVVAY
ASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSMLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMGKDYRDAIDVMFDNQRFGQKNQLGFYRYSQDNKGKP
RKDNDEQTDVLLAEVSQPRQTISDEEIIARMMIPMINEVVRCLEENIIASPAEADMALVY
GIGFPPFHGGAFRYLDTLGTANYVELAQRYAHLGALYQVPAGLRAKAEHNESYYPVAAPL
SDVSTGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacattacaactgcactggctcgacaacggcatcgccgagctg
gtgttcaatgccccaggctcggtaaacaagctcgatacccgcaccgttgccagcctgggc
gaagcgctcgcggtgctggaaaagcagaccgagttgaaaggcctgctgttgcgttctacc
aaggccgcctttattgtcggcgccgacatcaccgaattcctttcgctgtttgctgccccg
gctgaaaagctgcaggagtggctgaacttcgccaatgcgatctttaaccggctggaagat
ctgccggtgccgaccatttcggccattaacggctatgcgctcggcggcggctgcgaatgt
attctggcgaccgacttccgcgtcgcatccccggatgcgcgtatcggcctgccggaaacc
aaactgggtattatgccgggcttcggcggctccgttcgcttgccacgccttttgggtaac
gacagcgcactggaaattattgccgccggtaaggacgtcagtgccaaagatgcactgaag
gtcggcctggtggatgcggtagttgcaccggaaaagttggtggaagccgcgctgaaaatg
ctgcaacaggcgattgagggcaaactggactggcgcgcctatcgccaaccaaagctcgag
ccgttgaaactcagcccaatcgaagcggccatgagcttcaccaccgccaaaggcatggtg
atgcaaaccgctggcaaacattatccggcgccgatgaccgcggtcaaaaccattgaggcc
gccgccaggctgggccgtgatgaagcactgaaactggaaaccgccagctttgtgccattg
gcccgctccaaagaggcgcgcgcgctggtcggcatcttcctcaatgaccagtttgtgaaa
ggtcaggcgaagaagctggcgaagggtattgaagcaccgaaacaggctgcggtgttgggc
gccggtatcatgggtggcggtatcgcctaccagtcggctctgaaaggcgtgccggttgtc
atgaaagacatcagcgacaaatccctgactctcggtatgaatgaagccgccaaactgctg
aacaagcagttggaacgcggcaagctggacggcatgaagatggcccaggtgctatcgacc
attcaaccgacgctggattacgccggtatcgaacgcgcgcaggtgatcgtcgaagccgtg
gtcgagaatccaaagattaaggcggcagtattgtccgaagtggaaggcctgatcggtgaa
aataccgtactggcgtccaatacctcgaccattccgattaatcacctggcgaaatcgctg
aagcgcccacagaacttctgcggtatgcacttctttaatccggtacaccgcatgccactg
gtggaaattatccgcggcgagcagaccagcgacagcactatcgccgccgtggtggcctat
gccagccgtatgggtaaaacgccgattgtggttaacgactgcccagggttcttcgtcaac
cgtgtactgttcccgtattttgccggtttcagcatgttgctgcgcgacggtgcggacttc
cgccagatcgataaagtgatggaaaaacagtttggctggccaatgggcccggcttatctg
ctcgacgtagtggggattgataccgcgcaccacgcccaggcggtgatggcggccggtttc
ccggaacgcatgggtaaagattaccgcgacgctatcgacgtgatgttcgataaccagcgt
tttggtcagaaaaaccagttgggcttctatcgctacagccaggacaacaaaggcaagccg
cgtaaagacaacgatgagcagaccgatgtgctgctggccgaagtcagccaaccgcgtcag
accatcagcgacgaagaaattatcgcccgcatgatgatcccgatgattaacgaagtggtg
cgctgtctggaagaaaacattattgccagcccggccgaagccgatatggcgctggtctac
ggcatcggtttccctccgttccacggcggggcgttccgttacctggatacgcttggtacc
gccaattatgtcgaactggcccagcgttatgcgcatctcggtgctttgtatcaggtgcct
gccggcctgcgcgccaaagctgaacataatgaaagctactacccggtggcagcgccgctg
tccgatgtctccactggccaaccggcatga

DBGET integrated database retrieval system